FGL2/Fibroleukin Antibody (6D9)

Images

 
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - FGL2 monoclonal antibody (M01), clone 6D9. Analysis of FGL2 expression in Raw 264.7.
Immunohistochemistry-Paraffin: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Analysis of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 0.5 ug/ml.
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - FGL2 monoclonal antibody (M01), clone 6D9 Analysis of FGL2 expression in HeLa.
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - FGL2 monoclonal antibody (M01), clone 6D9. Analysis of FGL2 expression in PC-12.
Western Blot: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody (M01), clone 6D9.Lane 1: FGL2 transfected lysate(50 KDa).Lane 2: ...read more
Immunoprecipitation: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Analysis of FGL2 transfected lysate using anti-FGL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGL2 MaxPab rabbit ...read more
ELISA: FGL2/Fibroleukin Antibody (6D9) [H00010875-M01] - Detection limit for recombinant GST tagged FGL2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clone
6D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGL2/Fibroleukin Antibody (6D9) Summary

Immunogen
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Specificity
FGL2 (6D9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Flow Cytometry
  • Functional
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 0.5ug/mL
  • Immunoprecipitation 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot.
Control
HeLa Whole Cell Lysate
Publications
Read Publications using H00010875-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGL2/Fibroleukin Antibody (6D9)

  • FGL2
  • fibrinogen-like 2
  • Fibrinogen-like protein 2
  • Fibroleukin
  • pT49T49
  • T49

Background

The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2724
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NBP2-75649
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ

Publications for FGL2/Fibroleukin Antibody (H00010875-M01)(13)


Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using H00010875-M01 Applications Species
Sun HJ, Chen J, Zhang H et al. Von Willebrand factor protects against acute CCl4-induced hepatotoxicity through phospho-p38 MAPK signaling pathway inhibition. munol Res Sep 3 2017 [PMID: 28868583]
Wang M, Liu J, Xi D et al. Adenovirus-Mediated artificial miRNA against Human Fibrinogen Like Protein 2 Inhibits Hepatocellular Carcinoma Growth. J Gene Med 2016 May 10 [PMID: 27163335]
Long R, You Y, Li W et al. Sodium tanshinone IIA sulfonate ameliorates experimental coronary no-reflow phenomenon through down-regulation of FGL2. Life Sci. 2015 Oct 16 [PMID: 26482204]
Sun Y, Xi D, Ding W et al. Soluble FGL2, a novel effector molecule of activated hepatic stellate cells, regulates T-cell function in cirrhotic patients with hepatocellular carcinoma. Hepatol Int. 2014 Sep 25 [PMID: 25298849]
Li WZ, Wang J, Long R et al. Novel Antibody against a Glutamic Acid-Rich Human Fibrinogen-Like Protein 2-Derived Peptide near Ser91 Inhibits hfgl2 Prothrombinase Activity. PLoS One. 2014 Apr 11 [PMID: 24728278]
Xu GL, Chen J, Yang F et al. C5a/C5aR pathway is essential for the pathogenesis of murine viral fulminant hepatitis via potentiating Fgl2/fibroleukin expression. Hepatology. 2014 May 28 [PMID: 24604562]
Ye X, Huai J, Chen R et al. Correlation of fibrinogen-like protein 2 with disease progression in patients with severe acute pancreatitis. Exp Ther Med. 2013 Oct 22 [PMID: 24348769]
Xi D, Wang M, Ye H et al. Combined Adenovirus-Mediated Artificial microRNAs Targeting mfgl2, mFas, and mTNFR1 Protect against Fulminant Hepatic Failure in Mice. PLoS One. 2013 Nov 26 [PMID: 24303082]
Dong X, Ye X, Chen X et al. Intestinal and peripheral fibrinogen-like protein 2 expression in inflammatory bowel disease. Dig Dis Sci. 2013 Nov 28 [PMID: 24287641]
Selzner N, Liu H, Boehnert MU et al. FGL2/Fibroleukin Mediates Hepatic Reperfusion Injury by Induction of Sinusoidal Endothelial Cell and Hepatocyte Apoptosis in Mice. J Hepatol. 2011 Jul 01 [PMID: 21756857]
Show All 13 Publications.

Reviews for FGL2/Fibroleukin Antibody (H00010875-M01) (0)

There are no reviews for FGL2/Fibroleukin Antibody (H00010875-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FGL2/Fibroleukin Antibody (H00010875-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FGL2/Fibroleukin Products

Bioinformatics Tool for FGL2/Fibroleukin Antibody (H00010875-M01)

Discover related pathways, diseases and genes to FGL2/Fibroleukin Antibody (H00010875-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGL2/Fibroleukin Antibody (H00010875-M01)

Discover more about diseases related to FGL2/Fibroleukin Antibody (H00010875-M01).
 

Pathways for FGL2/Fibroleukin Antibody (H00010875-M01)

View related products by pathway.

PTMs for FGL2/Fibroleukin Antibody (H00010875-M01)

Learn more about PTMs related to FGL2/Fibroleukin Antibody (H00010875-M01).
 

Research Areas for FGL2/Fibroleukin Antibody (H00010875-M01)

Find related products by research area.

Blogs on FGL2/Fibroleukin

There are no specific blogs for FGL2/Fibroleukin, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGL2/Fibroleukin Antibody (6D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGL2
Entrez
OMIM
Uniprot