CLEC4D/CLECSF8 Antibody

Images

 
Western Blot: CLEC4D/CLECSF8 Antibody [NBP1-84445] - Analysis in control (vector only transfected HEK293T lysate) and CLEC4D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: CLEC4D/CLECSF8 Antibody [NBP1-84445] - Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLEC4D/CLECSF8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC4D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CLEC4D/CLECSF8 Protein (NBP1-84445PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLEC4D/CLECSF8 Antibody

  • CD368
  • CLEC4D
  • CLEC6
  • CLEC-6
  • CLECSF8
  • CLECSF8Mpcl
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 8
  • C-type lectin domain family 4 member D
  • C-type lectin domain family 4, member D
  • C-type lectin receptor
  • C-type lectin superfamily member 8
  • C-type lectin-like receptor 6
  • macrophage C-type lectin
  • MCL
  • MGC40078
  • Mpcl

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-49311
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
DDX0180P-100
Species: Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, Flow-CS

Publications for CLEC4D/CLECSF8 Antibody (NBP1-84445) (0)

There are no publications for CLEC4D/CLECSF8 Antibody (NBP1-84445).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLEC4D/CLECSF8 Antibody (NBP1-84445) (0)

There are no reviews for CLEC4D/CLECSF8 Antibody (NBP1-84445). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLEC4D/CLECSF8 Antibody (NBP1-84445) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLEC4D/CLECSF8 Products

Bioinformatics Tool for CLEC4D/CLECSF8 Antibody (NBP1-84445)

Discover related pathways, diseases and genes to CLEC4D/CLECSF8 Antibody (NBP1-84445). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CLEC4D/CLECSF8 Antibody (NBP1-84445)

Discover more about diseases related to CLEC4D/CLECSF8 Antibody (NBP1-84445).
 

Pathways for CLEC4D/CLECSF8 Antibody (NBP1-84445)

View related products by pathway.

Blogs on CLEC4D/CLECSF8

There are no specific blogs for CLEC4D/CLECSF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLEC4D/CLECSF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC4D
Entrez