Claudin-18 Antibody

Images

 
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Claudin-18 Antibody [NBP2-32002] - Staining in human stomach and liver tissues using anti-CLDN18 antibody. Corresponding CLDN18 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Claudin-18 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Specificity
Specificity of human Claudin-18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Claudin-18 Protein (NBP2-32002PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Claudin-18 Antibody

  • claudin 18
  • Claudin18
  • Claudin-18
  • CLDN18
  • DKFZp564B2062
  • SFTA5
  • SFTPJ
  • surfactant associated 5
  • surfactant associated protein J
  • surfactant, pulmonary associated protein J

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-85683
Species: Hu
Applications: IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-IC
MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-44374
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP1-82470
Species: Hu, Mu
Applications: IHC, IHC-P
AF1379
Species: Hu
Applications: WB, IHC
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-02259
Species: Hu, Po
Applications: Flow, ICC/IF, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-38777
Species: Hu
Applications: IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32002
Species: Hu
Applications: IHC, IHC-P

Publications for Claudin-18 Antibody (NBP2-32002) (0)

There are no publications for Claudin-18 Antibody (NBP2-32002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-18 Antibody (NBP2-32002) (0)

There are no reviews for Claudin-18 Antibody (NBP2-32002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Claudin-18 Antibody (NBP2-32002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Claudin-18 Products

Bioinformatics Tool for Claudin-18 Antibody (NBP2-32002)

Discover related pathways, diseases and genes to Claudin-18 Antibody (NBP2-32002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-18 Antibody (NBP2-32002)

Discover more about diseases related to Claudin-18 Antibody (NBP2-32002).
 

Pathways for Claudin-18 Antibody (NBP2-32002)

View related products by pathway.

PTMs for Claudin-18 Antibody (NBP2-32002)

Learn more about PTMs related to Claudin-18 Antibody (NBP2-32002).

Blogs on Claudin-18

There are no specific blogs for Claudin-18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN18
Entrez
Uniprot