CKAP4/p63 Antibody - BSA Free

Western Blot: CKAP4/p63 Antibody [NBP2-55266] - Analysis in human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: CKAP4/p63 Antibody [NBP2-55266] - Staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.

Western Blot: CKAP4/p63 Antibody [NBP2-55266] - Analysis using Anti-CKAP4 antibody NBP2-55266 (A) shows similar pattern to independent antibody NBP1-85572 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKAP4/p63 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKAP4/p63 Antibody - BSA Free (NBP2-55266) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKAP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CKAP4/p63 Antibody - BSA Free

• 63 kDa membrane protein
• CKAP4
• CLIMP-63
• cytoskeleton-associated protein 4
• ERGIC-63
• MGC99554
• p63
• transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
• type-II transmembrane protein p63

Background

Cytoskeleton-associated protein 4 (CKAP4) is also known as p63 and cytoskeleton-linking membrane protein 63kDa (CLIMP-63). It was first described as a palmitoylated single-pass transmembrane receptor that localized to the rough endoplasmic reticulum as well as the cell membrane. CKAP4 has been shown to help anchor endoplasmic reticulum to microtubules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKAP4