CKAP4/p63 Antibody

Images

 
Western Blot: CKAP4/p63 Antibody [NBP2-55266] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: CKAP4/p63 Antibody [NBP2-55266] - Staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Independent Antibodies: Western Blot: CKAP4/p63 Antibody [NBP2-55266] - Analysis using Anti-CKAP4 antibody NBP2-55266 (A) shows similar pattern to independent antibody NBP1-85572 (B).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

CKAP4/p63 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Specificity
Specificity of human CKAP4/p63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKAP4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 83%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CKAP4/p63 Antibody

  • 63 kDa membrane protein
  • CKAP4
  • CLIMP-63
  • cytoskeleton-associated protein 4
  • ERGIC-63
  • MGC99554
  • p63
  • transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
  • type-II transmembrane protein p63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1916
Species: Hu
Applications: WB, IHC, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84161
Species: Hu
Applications: IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-56916
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87168
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-47940
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CKAP4/p63 Antibody (NBP2-55266) (0)

There are no publications for CKAP4/p63 Antibody (NBP2-55266).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKAP4/p63 Antibody (NBP2-55266) (0)

There are no reviews for CKAP4/p63 Antibody (NBP2-55266). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CKAP4/p63 Antibody (NBP2-55266) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CKAP4/p63 Products

Bioinformatics Tool for CKAP4/p63 Antibody (NBP2-55266)

Discover related pathways, diseases and genes to CKAP4/p63 Antibody (NBP2-55266). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKAP4/p63 Antibody (NBP2-55266)

Discover more about diseases related to CKAP4/p63 Antibody (NBP2-55266).
 

Pathways for CKAP4/p63 Antibody (NBP2-55266)

View related products by pathway.

PTMs for CKAP4/p63 Antibody (NBP2-55266)

Learn more about PTMs related to CKAP4/p63 Antibody (NBP2-55266).

Blogs on CKAP4/p63

There are no specific blogs for CKAP4/p63, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKAP4/p63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CKAP4