ARHGAP24 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP24 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSD
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGAP24 Protein (NBP1-84161PEP)
Publications
Read Publication using NBP1-84161.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP24 Antibody

  • DKFZP564B1162
  • Filamin-A-associated RhoGAP
  • FilGAP
  • FILGAPRCGAP72
  • FLJ33877
  • p73
  • p73RhoGAP
  • RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
  • RC-GAP72
  • Rho GTPase activating protein 24
  • rho GTPase-activating protein 24
  • RhoGAP of 73 kDa
  • Rho-type GTPase-activating protein 24
  • Sarcoma antigen NY-SAR-88

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1916
Species: Hu
Applications: ICC, IHC, WB
NBP1-85572
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-18885
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NB100-355
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, In vivo, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-2736
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB100-59774
Species: Hu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NBP2-24737
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-56370
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-67338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84161
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for ARHGAP24 Antibody (NBP1-84161)(1)

Reviews for ARHGAP24 Antibody (NBP1-84161) (0)

There are no reviews for ARHGAP24 Antibody (NBP1-84161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARHGAP24 Antibody (NBP1-84161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGAP24 Products

Bioinformatics Tool for ARHGAP24 Antibody (NBP1-84161)

Discover related pathways, diseases and genes to ARHGAP24 Antibody (NBP1-84161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP24 Antibody (NBP1-84161)

Discover more about diseases related to ARHGAP24 Antibody (NBP1-84161).
 

Pathways for ARHGAP24 Antibody (NBP1-84161)

View related products by pathway.

PTMs for ARHGAP24 Antibody (NBP1-84161)

Learn more about PTMs related to ARHGAP24 Antibody (NBP1-84161).

Blogs on ARHGAP24

There are no specific blogs for ARHGAP24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP24
Entrez
Uniprot