CKAP4/p63 Antibody - BSA Free

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85572 (A) shows similar protein distribution across tissues to independent antibody NBP1-85571 (B).

Western Blot: CKAP4/p63 Antibody [NBP1-85572] - Analysis using Anti-CKAP4 antibody NBP1-85572 (A) shows similar pattern to independent antibody NBP1-85571 (B).

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human bone marrow using Anti-CKAP4 antibody.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human cervix, uterine using Anti-CKAP4 antibody NBP1-85572.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human skeletal muscle using Anti-CKAP4 antibody NBP1-85572.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85572] - Staining of human cervix, uterine shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CKAP4/p63 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CKAP4/p63 Antibody - BSA Free (NBP1-85572) is a polyclonal antibody validated for use in IHC and WB. Anti-CKAP4/p63 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKAP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CKAP4/p63 Protein (NBP1-85572PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CKAP4/p63 Antibody - BSA Free

• 63 kDa membrane protein
• CKAP4
• CLIMP-63
• cytoskeleton-associated protein 4
• ERGIC-63
• MGC99554
• p63
• transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
• type-II transmembrane protein p63

Background

Cytoskeleton-associated protein 4 (CKAP4) is also known as p63 and cytoskeleton-linking membrane protein 63kDa (CLIMP-63). It was first described as a palmitoylated single-pass transmembrane receptor that localized to the rough endoplasmic reticulum as well as the cell membrane. CKAP4 has been shown to help anchor endoplasmic reticulum to microtubules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CKAP4/p63 Antibody (NBP1-85572)(1)

Publication using NBP1-85572

• Ek S, Andreasson U, Hober S et al. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Mol Cell Proteomics 2006-06-01 [PMID: 16524965]

Bioinformatics

• Gene Symbol: CKAP4