CKAP4/p63 Antibody

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 (A) shows similar protein distribution across tissues to independent antibody NBP1-85572 (B).

Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human skeletal muscle using Anti-CKAP4 antibody NBP1-85571.

Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow using Anti-CKAP4 antibody.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cerebral cortex using Anti-CKAP4 antibody.

Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine using Anti-CKAP4 antibody NBP1-85571.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CKAP4/p63 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CKAP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CKAP4/p63 Recombinant Protein Antigen (NBP1-85571PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CKAP4/p63 Antibody

• 63 kDa membrane protein
• CKAP4
• CLIMP-63
• cytoskeleton-associated protein 4
• ERGIC-63
• MGC99554
• p63
• transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
• type-II transmembrane protein p63

Background

Cytoskeleton-associated protein 4 (CKAP4) is also known as p63 and cytoskeleton-linking membrane protein 63kDa (CLIMP-63). It was first described as a palmitoylated single-pass transmembrane receptor that localized to the rough endoplasmic reticulum as well as the cell membrane. CKAP4 has been shown to help anchor endoplasmic reticulum to microtubules.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CKAP4