Home » CKAP4/p63 » CKAP4/p63 Antibodies » CKAP4/p63 Antibody

CKAP4/p63 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis using Anti-CKAP4 antibody NBP1-85571 (A) shows similar pattern to independent antibody NBP1-85572 (B).
Independent Antibodies: Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis using Anti-CKAP4 antibody NBP1-85571 (A) shows similar pattern to independent antibody NBP1-85572 (B).
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cerebral cortex using Anti-CKAP4 antibody.
Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Orthogonal Strategies: Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 ...read more
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow using Anti-CKAP4 antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CKAP4/p63 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Specificity
Specificity of human, mouse, rat CKAP4/p63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CKAP4/p63 Antibody

  • 63 kDa membrane protein
  • CKAP4
  • CLIMP-63
  • cytoskeleton-associated protein 4
  • ERGIC-63
  • MGC99554
  • p63
  • transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
  • type-II transmembrane protein p63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
Species: Hu
Applications: WB, IHC, ICC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(23 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
p73 Antibody
(5B429)
NBP2-24737
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Analysis of p73 in A) transfected cell lysate and B) HeLa cell lysate at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: p73 Antibody (5B429) [NBP2-24737] - p73 was detected in immersion fixed Hela human cell line using p73 [5B429] Monoclonal Antibody (Catalog # NBP2-24737) at 3 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and in the nuclei.
Immunohistochemistry-Paraffin: p73 Antibody (5B429) [NBP2-24737] - FFPE breast cancer probed with p73 antibody at 5 ug/ml. Human tissue was used for this test. Staining of tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(53 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded prostate stained with Cytokeratin 14 Monoclonal Antibody (LL002).
Flow Cytometry: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Flow Cytometry: Cytokeratin 14 Antibody (LL002) [Alexa Fluor® 488] [NBP2-34675AF488] - An intracellular stain was performed on HeLa cells with Cytokeratin 14 Antibody (LL002) NBP2-34675AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes. Both antibodies were conjugated to Alexa Fluor 488. Image using the Alexa Fluor 488 form of this antibody.
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded human prostate (10X) stained with Cytokeratin 14 MAb (LL002).
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Cytokeratin 5
Antibody (2C2)
NBP2-22194
Western Blot: Cytokeratin 5 Antibody (2C2) [NBP2-22194] - Analysis using Cytokeratin 5 mouse mAb against A431 (1), MCF-7 (2), HeLa (3), HepG2 (4), 3T3-L1 (5), and COS-7 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (2C2) [NBP2-22194] - Immunofluorescence analysis of HeLa cells. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody (2C2) [NBP2-22194] - Analysis of stomach cancer tissues using Cytokeratin 5 mouse mAb with DAB staining.
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(13 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

alpha-Methylacyl-CoA R ...
NBP1-87168
Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Analysis using Anti-AMACR antibody NBP1-87168 (A) shows similar pattern to independent antibody NBP1-87169 (B).
Immunocytochemistry/Immunofluorescence: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human lymph node.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - TTF1 staining in thyroid tissue of wild-type C57 mouse (red). Dilution is 1:100. Image from a verified customer review.
Immunohistochemistry-Paraffin: TTF1 / NKX2.1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin: TTF1 / NKX2.1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
Cytokeratin 19
Antibody
NB100-687
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Analysis of Cytokeratin 19 in 1) HepG2 and 2) MCF7 lysates.
Immunocytochemistry/Immunofluorescence: Cytokeratin 19 Antibody [NB100-687] - MCF7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: Cytokeratin 19 Antibody [NB100-687] - Staining of Cytokeratin 19 in human kidney carcinoma using DAB with hematoxylin counterstain.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
EGFR [p Tyr1173]
Antibody [Unconjugate ...
AF1095
Western blot shows lysates of A431 human epithelial carcinoma cell line untreated(‑) or treated (+) with 100 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human Phospho-EGFR (Y1173) Antigen Affinity-purified Polyclonal Antibody, followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-EGFR (Y1173) at approximately 185 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line untreated (-) or treated (+) with 10 ng/mL Recombinant Human EGF (Catalog # 236-EG) for 5 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-EGFR (Y1173) at approximately 265 kDa (as indicated) using 2 µg/mL of Rabbit Anti-Human Phospho-EGFR (Y1173) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1095). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
EGFR phosphorylated at Y1173 was detected in immersion fixed A431 human epithelial carcinoma cell line untreated (lower panel) or treated (upper panel) with pervanadate using Rabbit Anti-Human Phospho-EGFR (Y1173) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1095) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
Cytokeratin 7
Antibody
NBP1-88080
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining in human placenta and skeletal muscle tissues. Corresponding KRT7 RNA-seq data are presented for the same tissues.
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell lines A-549 and HEK293 using Anti-KRT7 antibody. Corresponding KRT7 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. Image from verified customer review.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
(5 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
p16INK4a/CDKN2A
Antibody
NB200-106
Western Blot: p16INK4a/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p16INK4a/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p16INK4a/CDKN2A Antibody [NB200-106] - Analysis of FFPE mouse spleen using p16INK4a/CDKN2A antibody at 10 ug/mL on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(41 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(35 Publications)
Species: Hu
RNA polymerase I
termination factor An ...
NBP2-38740
Western Blot: RNA polymerase I termination factor Antibody [NBP2-38740] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/Immunofluorescence: RNA polymerase I termination factor Antibody [NBP2-38740] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Species: Hu
Applications: WB, IHC, IHC-P
Neprilysin/CD10
Antibody [Unconjugate
AF1182
Western blot shows lysates of LNCaP human prostate cancer cell line and PC‑3 human prostate cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1182) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, Recombinant Mouse Neprilysin (Catalog # 1126-ZN) (5 and 50 ng/lane) and Recombinant Human Neprilysin (CHO-expressed) (Catalog # 1182-ZNC) (5 and 50 ng/lane) were included. Specific bands were detected for Neprilysin/CD10 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neprilysin/CD10 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1182) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)

Publications for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no publications for CKAP4/p63 Antibody (NBP1-85571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no reviews for CKAP4/p63 Antibody (NBP1-85571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CKAP4/p63 Products

Bioinformatics Tool for CKAP4/p63 Antibody (NBP1-85571)

Discover related pathways, diseases and genes to CKAP4/p63 Antibody (NBP1-85571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKAP4/p63 Antibody (NBP1-85571)

Discover more about diseases related to CKAP4/p63 Antibody (NBP1-85571).
 

Pathways for CKAP4/p63 Antibody (NBP1-85571)

View related products by pathway.

PTMs for CKAP4/p63 Antibody (NBP1-85571)

Learn more about PTMs related to CKAP4/p63 Antibody (NBP1-85571).

Blogs on CKAP4/p63

There are no specific blogs for CKAP4/p63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKAP4/p63 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CKAP4