Home » CKAP4/p63 » CKAP4/p63 Antibodies » CKAP4/p63 Antibody

CKAP4/p63 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Orthogonal Strategies: Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human skeletal muscle using Anti-CKAP4 antibody NBP1-85571.
Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 ...read more
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow using Anti-CKAP4 antibody.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cerebral cortex using Anti-CKAP4 antibody.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine using Anti-CKAP4 antibody NBP1-85571.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CKAP4/p63 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CKAP4/p63 Recombinant Protein Antigen (NBP1-85571PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CKAP4/p63 Antibody

  • 63 kDa membrane protein
  • CKAP4
  • CLIMP-63
  • cytoskeleton-associated protein 4
  • ERGIC-63
  • MGC99554
  • p63
  • transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
  • type-II transmembrane protein p63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p73 Antibody
(5B429) - BSA Free
NBP2-24737
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Consequences of DHX9 knockdown on protein levels of p53 targets in HCT116 p53+/+ and p53-/- cells. Western blot analysis of p53 transcriptional targets in HCT116 p53+/+ and p53-/- cells. Cells were harvested 6 days post-transduction and extracts were fractionated on 8% SDS-PAGE gels. All probings were performed on the same blot. Actin and eEF2 are used as loading controls. Quantitation of intensity levels of the proteins in the shDHX9 samples relative to the shFLuc. 1309 samples are indicated beneath each band. Image collected and cropped by CiteAb from the following publication (https://www.oncotarget.com/article/15889/text/), licensed under a CC-BY licence.
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Analysis of p73 in A) transfected cell lysate and B) HeLa cell lysate at 2 ug/ml.
Immunohistochemistry-Paraffin: p73 Antibody (5B429) [NBP2-24737] - FFPE breast cancer probed with p73 antibody at 5 ug/ml. Human tissue was used for this test. Staining of tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(57 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Flow Cytometry: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Flow Cytometric Analysis of trypsinized MeOH-fixed HeLa cells using Cytokeratin 14 Antibody (LL002) followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Immunocytochemistry/Immunofluorescence: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Immunofluorescence Analysis of A549 cells labeling CK14 with Cytokeratin 14 Antibody (LL002) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Red Dot (Red).
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded human Prostate Carcinoma stained with Cytokeratin 14 Antibody (LL002).
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Cytokeratin 5
Antibody (EP1601Y)
NB110-56916
Western Blot: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Expression of cytokeratins (CK) and GAPDH in HMGEC. Representative western blots show specific bands for GAPDH, CK1, Cytokeratin 5, CK6 and CK14. Image collected and cropped by CiteAb from the following publication (https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0128096) licensed under a CC-BY licence.
Simple Western: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Simple Western lane view shows a specific band for Cytokeratin 5 in 0.5 mg/ml of A431 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - A431 cells.
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

alpha-Methylacyl-CoA R ...
NBP1-87168
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining in human kidney and pancreas tissues using anti-AMACR antibody. Corresponding AMACR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - TTF1 staining in thyroid tissue of wild-type C57 mouse (red). Dilution is 1:100. Image from a verified customer review.
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry: Cytokeratin 19 Antibody [NB100-687] - An intracellular stain was performed on MCF7 cells with Cytokeratin 19 Antibody NB100-687AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Western blot detection of YAP and TAZ in proteins extracted from isolated hepatocytes and cholangiocytes and total liver tissue. Antibodies against CK19 and HNF4a were used to confirm purity of the populations and b-actin was used as a loading control. Representative results from a single experiment with n = 3 independent cell isolations and n = 2 total liver tissues. Image collected and cropped by CiteAb from the following publication(http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
Immunohistochemistry: Cytokeratin 19 Antibody [NB100-687] - Inhibition of MST improves liver regeneration in aged mice. Representative photomicrograph of an aged liver treated with siMST and stained with H&E and by IHC for CK19 and Ki67. Arrows indicate ductal regions with no signs of reaction or oval cell expansion. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(15 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Lane view shows a specific band for Cytokeratin 7 at 5 ug/mL in HeLa cell lysate.Electropherogram image of corresponding Simple Western lane view at WES molecular weight of 61 kDa. Image from an internal validation.
Flow Cytometry: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Flow Cytometric Analysis of HeLa cells using Cytokeratin 7 Antibody (OV-TL12/30) followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
Simple Western: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Electropherogram image of the corresponding Simple Western lane. Cytokeratin 7 antibody was used at 1 ug/mL dilution of HeLa lysates(s) respectively.
(1 Review)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(10 Reviews)
(53 Publications)
Species: Hu
Applications: BA
RNA polymerase I
termination factor An ...
NBP2-38740
Immunocytochemistry/Immunofluorescence: RNA polymerase I termination factor Antibody [NBP2-38740] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human liver shows weak nuclear positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cervix shows moderate to strong positivity in mucus in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Neprilysin/CD10 was detected in perfusion fixed frozen sections of mouse brain (glial cell in hippocampus) using 15 µg/mL Goat Anti-Mouse Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1126) overnight at 4 °C. Tissue was stained (red) and counterstained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(8 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

Publications for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no publications for CKAP4/p63 Antibody (NBP1-85571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no reviews for CKAP4/p63 Antibody (NBP1-85571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CKAP4/p63 Products

Bioinformatics Tool for CKAP4/p63 Antibody (NBP1-85571)

Discover related pathways, diseases and genes to CKAP4/p63 Antibody (NBP1-85571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKAP4/p63 Antibody (NBP1-85571)

Discover more about diseases related to CKAP4/p63 Antibody (NBP1-85571).
 

Pathways for CKAP4/p63 Antibody (NBP1-85571)

View related products by pathway.

PTMs for CKAP4/p63 Antibody (NBP1-85571)

Learn more about PTMs related to CKAP4/p63 Antibody (NBP1-85571).

Blogs on CKAP4/p63

There are no specific blogs for CKAP4/p63, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKAP4/p63 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CKAP4