Home » CKAP4/p63 » CKAP4/p63 Antibodies » CKAP4/p63 Antibody

CKAP4/p63 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Orthogonal Strategies: Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human skeletal muscle using Anti-CKAP4 antibody NBP1-85571.
Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 ...read more
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow using Anti-CKAP4 antibody.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cerebral cortex using Anti-CKAP4 antibody.
Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine using Anti-CKAP4 antibody NBP1-85571.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

CKAP4/p63 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Specificity
Specificity of human, mouse, rat CKAP4/p63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKAP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CKAP4/p63 Protein (NBP1-85571PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CKAP4/p63 Antibody

  • 63 kDa membrane protein
  • CKAP4
  • CLIMP-63
  • cytoskeleton-associated protein 4
  • ERGIC-63
  • MGC99554
  • p63
  • transmembrane protein (63kD), endoplasmic reticulum/Golgi intermediatecompartment
  • type-II transmembrane protein p63

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
p73 Antibody
(5B429)
NBP2-24737
Western Blot: p73 Antibody (5B429) [NBP2-24737] - Analysis of p73 in A) transfected cell lysate and B) HeLa cell lysate at 2 ug/ml.
Immunocytochemistry/Immunofluorescence: p73 Antibody (5B429) [NBP2-24737] - p73 was detected in immersion fixed Hela human cell line using p73 [5B429] Monoclonal Antibody (Catalog # NBP2-24737) at 3 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Staining was observed in the cytoplasm and in the nuclei.
Immunohistochemistry-Paraffin: p73 Antibody (5B429) [NBP2-24737] - FFPE breast cancer probed with p73 antibody at 5 ug/ml. Human tissue was used for this test. Staining of tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(55 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ARHGAP24 Antibody
NBP1-84161
Immunohistochemistry-Paraffin: ARHGAP24 Antibody [NBP1-84161] - Staining of human kidney shows cytoplasmic positivity in renal tubules.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Cytokeratin 14
Antibody (LL002)
NBP2-34270
Immunocytochemistry/Immunofluorescence: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Immunofluorescence Analysis of A549 cells labeling CK14 with Cytokeratin 14 Antibody (LL002) followed by Goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Red Dot (Red).
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Formalin-fixed, paraffin-embedded human Prostate Carcinoma stained with Cytokeratin 14 Antibody (LL002).
Flow Cytometry: Cytokeratin 14 Antibody (LL002) [NBP2-34270] - Flow Cytometric Analysis of trypsinized MeOH-fixed HeLa cells using Cytokeratin 14 Antibody (LL002) followed by Goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Cytokeratin 5
Antibody (EP1601Y)
NB110-56916
Western Blot: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Expression of cytokeratins (CK) and GAPDH in HMGEC. Representative western blots show specific bands for GAPDH, CK1, Cytokeratin 5, CK6 and CK14. Image collected and cropped by CiteAb from the following publication (https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0128096) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - A431 cells.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Cytokeratin 5 (EP1601Y) on prostate.
(8 Publications)
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

alpha-Methylacyl-CoA R ...
NBP1-87168
Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Analysis using Anti-AMACR antibody NBP1-87168 (A) shows similar pattern to independent antibody NBP1-87169 (B).
Immunocytochemistry/Immunofluorescence: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody [NBP1-87168] - Staining of human pancreas using Anti-AMACR antibody NBP1-87168.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Lung Carcinoma stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - TTF1 staining in thyroid tissue of wild-type C57 mouse (red). Dilution is 1:100. Image from a verified customer review.
Immunohistochemistry-Paraffin: TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690) [NBP2-44501] - Human Thyroid stained with TTF-1 Monoclonal Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
Cytokeratin 19
Antibody
NB100-687
Simple Western: Cytokeratin 19 Antibody [NB100-687] - Lane view shows a specific band for Cytokeratin 19 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under standard reducing conditions using the 12-230 kDa separation system.
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Western blot detection of YAP and TAZ in proteins extracted from isolated hepatocytes and cholangiocytes and total liver tissue. Antibodies against CK19 and HNF4a were used to confirm purity of the populations and b-actin was used as a loading control. Representative results from a single experiment with n = 3 independent cell isolations and n = 2 total liver tissues. Image collected and cropped by CiteAb from the following publication(http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Cytokeratin 19 Antibody [NB100-687] - TUDCA induces intermediate states of mesenchymal and epithelial cells in primary cultures of rat HSC during hepatic differentiation. Under control conditions HSC remained negative for K19 (Cytokeratin 19) expression, (d) but this epithelial marker protein was induced in HSC cultures after treatment with 2 uM TUDCA for 14 days (red). (f) K19 was found to be co-expressed with desmin (green), which indicated the origin of epithelial progenitor cells from HSC. (I) Cells with different states of maturation were still found after 21 days of TUDCA treatment. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep13320), licensed under a CC-BY licence.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Western Blot: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Western Blot Analysis of human HeLa cell lysate using Cytokeratin 7 Antibody (OV-TL12/30).
Immunocytochemistry/Immunofluorescence: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Immunofluorescent staining of methanol-fixed HeLa cells. Cytokeratin 7 Antibody (OV-TL12/30) followed by goat anti-Mouse IgG-CF488 (Green). The nuclear counterstain is Red Dot.
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free [NBP2-47940] - Human Lung SCC stained with Cytokeratin 7 Monoclonal Antibody (OV-TL12/30)
(1 Review)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Vimentin Antibody
NB300-223
Western Blot: Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates. Antibody at 1:5000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5000 in green, revealing multiple bands around 280 kDa that correspond to full length MAP2A/2B isotypes, and ~70 kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Comparative analysis of epithelial and mesenchymal markers expressions. Fluorescence immunocytochemistry staining for E-cadherin (green), N-cadherin (red) and vimentin (cyan) was performed on esophageal cancer cells under static and microfluidic flow conditions at different time points. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep38221), licensed under a CC-BY licence.
Immunohistochemistry: Vimentin Antibody [NB300-223] - Increased numbers of differentiating NSPCs in SVZ of G93A-SOD1 brain. Confocal microscopy images of dorsal and ventral regions of SVZ in G93A-SOD1 and Wt-SOD1 brain at postnatal week 18, stained for nestin (green), GFAP (red), and vimentin (blue). Scale bar = 50 um. Image collected and cropped by CiteAb from the following publication (http://www.molecularbrain.com/content/8/1/5), licensed under a CC-BY licence.
(6 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(9 Reviews)
(43 Publications)
Species: Hu
RNA polymerase I
termination factor An ...
NBP2-38740
Western Blot: RNA polymerase I termination factor Antibody [NBP2-38740] - Analysis in human cell line MOLT-4.
Immunocytochemistry/Immunofluorescence: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RNA polymerase I termination factor Antibody [NBP2-38740] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Neprilysin/CD10
Antibody (SN75-07)
NBP2-67717
Western Blot: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of CD10 on Daudi cell lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunocytochemistry/Immunofluorescence: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Staining CD10 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody (SN75-07) [NBP2-67717] - Analysis of paraffin-embedded human tonsil tissue using anti-CD10 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no publications for CKAP4/p63 Antibody (NBP1-85571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no reviews for CKAP4/p63 Antibody (NBP1-85571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKAP4/p63 Antibody (NBP1-85571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CKAP4/p63 Products

Bioinformatics Tool for CKAP4/p63 Antibody (NBP1-85571)

Discover related pathways, diseases and genes to CKAP4/p63 Antibody (NBP1-85571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKAP4/p63 Antibody (NBP1-85571)

Discover more about diseases related to CKAP4/p63 Antibody (NBP1-85571).
 

Pathways for CKAP4/p63 Antibody (NBP1-85571)

View related products by pathway.

PTMs for CKAP4/p63 Antibody (NBP1-85571)

Learn more about PTMs related to CKAP4/p63 Antibody (NBP1-85571).

Blogs on CKAP4/p63

There are no specific blogs for CKAP4/p63, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKAP4/p63 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CKAP4