CITED1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CITED1 Antibody [NBP2-55317] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CITED1 Antibody [NBP2-55317] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CITED1 Antibody [NBP2-55317] - Staining of human epididymis shows weak cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: CITED1 Antibody [NBP2-55317] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CITED1 Antibody [NBP2-55317] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CITED1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CITED1 Antibody - BSA Free (NBP2-55317) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CITED1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-P Retrieval method: HIER pH6.
• Control Peptide:

  CITED1 Recombinant Protein Antigen (NBP2-55317PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CITED1 Antibody - BSA Free

• cbp/p300-interacting transactivator 1
• Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1
• melanocyte-specific gene 1

Background

CITED1 is highly expressed in most of the papillary thyroid carcinoma. It is not expressed in normal tissues except normal breast epithelium. Study shows that this protein functions as a selective coactivator for estrogen dependent transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CITED1