MEIS2 Antibody (1H4)

Images

 
Western Blot: MEIS2 Antibody (1H4) [H00004212-M01] - MEIS2 monoclonal antibody (M01), clone 1H4. Analysis of MEIS2 expression in K-562.
Immunocytochemistry/ Immunofluorescence: MEIS2 Antibody (1H4) [H00004212-M01] - Analysis of monoclonal antibody to MEIS2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: MEIS2 Antibody (1H4) [H00004212-M01] - Analysis of monoclonal antibody to MEIS2 on formalin-fixed paraffin-embedded human spleen tissue. Antibody concentration 1 ug/ml.
Western Blot: MEIS2 Antibody (1H4) [H00004212-M01] - MEIS2 monoclonal antibody (M01), clone 1H4 Analysis of MEIS2 expression in HeLa.
Western Blot: MEIS2 Antibody (1H4) [H00004212-M01] - Analysis of MEIS2 expression in transfected 293T cell line by MEIS2 monoclonal antibody (M01), clone 1H4.Lane 1: MEIS2 transfected lysate(51.1 KDa).Lane 2: ...read more
ELISA: MEIS2 Antibody (1H4) [H00004212-M01] - Detection limit for recombinant GST tagged MEIS2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1H4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEIS2 Antibody (1H4) Summary

Immunogen
MEIS2 (AAH01516, 1 a.a. - 381 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
Specificity
MEIS2 - Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MEIS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using H00004212-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEIS2 Antibody (1H4)

  • Meis (mouse) homolog 2
  • Meis homeobox 2
  • Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse)
  • Meis1-related gene 1
  • MGC2820
  • myeloid ecotropic viral integration site 1 homolog 2
  • TALE homeobox protein Meis2

Background

This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
423-F8/CF
Species: Hu, Mu
H00004435-M03
Species: Hu
Applications: WB, ELISA, Flow, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
26260002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB7555
Species: Hu
Applications: WB, Simple Western
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-03933
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu

Publications for MEIS2 Antibody (H00004212-M01)(4)

Reviews for MEIS2 Antibody (H00004212-M01) (0)

There are no reviews for MEIS2 Antibody (H00004212-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MEIS2 Antibody (H00004212-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEIS2 Products

Bioinformatics Tool for MEIS2 Antibody (H00004212-M01)

Discover related pathways, diseases and genes to MEIS2 Antibody (H00004212-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEIS2 Antibody (H00004212-M01)

Discover more about diseases related to MEIS2 Antibody (H00004212-M01).
 

Pathways for MEIS2 Antibody (H00004212-M01)

View related products by pathway.

PTMs for MEIS2 Antibody (H00004212-M01)

Learn more about PTMs related to MEIS2 Antibody (H00004212-M01).
 

Research Areas for MEIS2 Antibody (H00004212-M01)

Find related products by research area.

Blogs on MEIS2

There are no specific blogs for MEIS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEIS2 Antibody (1H4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MEIS2
Entrez
OMIM
Uniprot