CISH/CIS-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CISH/CIS-1 Antibody [NBP2-38474] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules & cytokinetic bridge. Antibody staining is shown in ...read more
Immunohistochemistry-Paraffin: CISH/CIS-1 Antibody [NBP2-38474] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CISH/CIS-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR
Specificity
Specificity of human CISH/CIS-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CISH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CISH/CIS-1 Protein (NBP2-38474PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CISH/CIS-1 Antibody

  • CIS-1
  • CIS-1cytokine-inducible SH2-containing protein
  • CIScytokine-inducible inhibitor of signaling type 1B
  • CISH
  • cytokine inducible SH2-containing protein
  • G18Protein G18
  • SOCS
  • Suppressor of cytokine signaling

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
AF4979
Species: Hu
Applications: WB
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF1360
Species: Mu
Applications: WB, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CISH/CIS-1 Antibody (NBP2-38474) (0)

There are no publications for CISH/CIS-1 Antibody (NBP2-38474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CISH/CIS-1 Antibody (NBP2-38474) (0)

There are no reviews for CISH/CIS-1 Antibody (NBP2-38474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CISH/CIS-1 Antibody (NBP2-38474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CISH/CIS-1 Antibody (NBP2-38474)

Discover related pathways, diseases and genes to CISH/CIS-1 Antibody (NBP2-38474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CISH/CIS-1 Antibody (NBP2-38474)

Discover more about diseases related to CISH/CIS-1 Antibody (NBP2-38474).
 

Pathways for CISH/CIS-1 Antibody (NBP2-38474)

View related products by pathway.

PTMs for CISH/CIS-1 Antibody (NBP2-38474)

Learn more about PTMs related to CISH/CIS-1 Antibody (NBP2-38474).
 

Research Areas for CISH/CIS-1 Antibody (NBP2-38474)

Find related products by research area.

Blogs on CISH/CIS-1

There are no specific blogs for CISH/CIS-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CISH/CIS-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CISH
Entrez
Uniprot