Chromogranin A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Chromogranin A Antibody [NBP1-86056] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Chromogranin A Antibody [NBP1-86056] - Staining in human parathyroid gland and liver tissues using anti-CHGA antibody. Corresponding CHGA RNA-seq data are presented for the same tissues.

Staining of human parathyroid gland shows strong membranous and cytoplasmic positivity in glandular cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.

Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Analysis in human plasma.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Chromogranin A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Chromogranin A Antibody - BSA Free (NBP1-86056) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Chromogranin A Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHGA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Chromogranin A Protein (NBP1-86056PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953), Mouse reactivity reported in scientific literature (PMID: 24843046).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Chromogranin A Antibody - BSA Free

• betagranin (N-terminal fragment of chromogranin A)
• Betagranin
• Catestatin
• CGA
• CHGA
• Chromofungin
• chromogranin A (parathyroid secretory protein 1)
• Chromogranin A
• chromogranin-A
• Pancreastatin
• Parastatin
• Parathyroid Secretory Protein 1
• Pituitary Secretory Protein I
• SP-I

Background

Chromogranin A (CgA) is an 86 kDa protein that is the major member of the granin family of acidic secretory glycoproteins located in neuroendocrine cells. CgA is believed to play a role in targeting peptide hormones and neurotransmitters to granules of the regulated pathways and inhibit hormone and neurotransmitter release. Also, the widespread distribution of CgA has made the measurement of circulating immunoreactive CgA a valuable tool in the diagnosis of neuroendocrine neoplasia, and CgA immunohistochemistry can help to identify the neuroendocrine nature of tumors. The N-terminal domain of CgA inhibits tumor necrosis factor a (TNFa) induced gap formation in human umbilical venous endothelial cells. CgA levels which reflect neuroendocrine differentiation of prostatic carcinoma may have a diagnostic, therapeutic and prognostic role in the management of prostate cancer patients.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Chromogranin A Antibody (NBP1-86056)(2)

Publications using NBP1-86056

• Marbiah MM, Harvey A, West BT et al. Identification of a gene regulatory network associated with prion replication. EMBO J 2014-07-17 [PMID: 24843046] (ICC/IF, Mouse)
• Kiflemariam S, Andersson S, Asplund A et al. Scalable in situ hybridization on tissue arrays for validation of novel cancer and tissue-specific biomarkers. PLoS One 2012-01-01 [PMID: 22412953]

FAQs for Chromogranin A Antibody (NBP1-86056). (Showing 1 - 1 of 1 FAQs).

1. I have following question about antibodies against Chromogranin A. Your products list the species but canine is not included. Does it mean that the products cannot be used on canine tissues?
   • When we do not list a species, it means we have not tested an antibody to work with those samples. If we test an antibody and find that it does not work, we will list the species with a minus sign. Unfortunately, we haven't tried these abs on canine tissues and they may work, but we cannot guarantee it. If you would like to purchase one to try, you will be eligible for the Innovators Reward Program.

Bioinformatics

• Gene Symbol: CHGA