Chromogranin A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Chromogranin A Antibody [NBP1-86056] - Staining of human cell line SH-SY5Y shows localization to vesicles.
Immunohistochemistry: Chromogranin A Antibody [NBP1-86056] - Staining of human rectum shows strong cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry: Chromogranin A Antibody [NBP1-86056] - Staining of human pancreas shows strong cytoplasmic positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chromogranin A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHGA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Chromogranin A Protein (NBP1-86056PEP)
Publications
Read Publications using
NBP1-86056 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22412953)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Chromogranin A Antibody

  • betagranin (N-terminal fragment of chromogranin A)
  • Betagranin
  • Catestatin
  • CGA
  • CHGA
  • Chromofungin
  • chromogranin A (parathyroid secretory protein 1)
  • Chromogranin A
  • chromogranin-A
  • Pancreastatin
  • Parastatin
  • Parathyroid Secretory Protein 1
  • Pituitary Secretory Protein I
  • SP-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-35213
Species: Hu
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-86056
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Chromogranin A Antibody (NBP1-86056)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Chromogranin A Antibody (NBP1-86056) (0)

There are no reviews for Chromogranin A Antibody (NBP1-86056). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Chromogranin A Antibody (NBP1-86056). (Showing 1 - 1 of 1 FAQs).

  1. I have following question about antibodies against Chromogranin A. Your products list the species but canine is not included. Does it mean that the products cannot be used on canine tissues?
    • When we do not list a species, it means we have not tested an antibody to work with those samples. If we test an antibody and find that it does not work, we will list the species with a minus sign. Unfortunately, we haven't tried these abs on canine tissues and they may work, but we cannot guarantee it. If you would like to purchase one to try, you will be eligible for the Innovators Reward Program.

Secondary Antibodies

 

Isotype Controls

Additional Chromogranin A Products

Bioinformatics Tool for Chromogranin A Antibody (NBP1-86056)

Discover related pathways, diseases and genes to Chromogranin A Antibody (NBP1-86056). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chromogranin A Antibody (NBP1-86056)

Discover more about diseases related to Chromogranin A Antibody (NBP1-86056).
 

Pathways for Chromogranin A Antibody (NBP1-86056)

View related products by pathway.

PTMs for Chromogranin A Antibody (NBP1-86056)

Learn more about PTMs related to Chromogranin A Antibody (NBP1-86056).
 

Research Areas for Chromogranin A Antibody (NBP1-86056)

Find related products by research area.

Blogs on Chromogranin A.

Beta Tubulin III and neurogenesis
Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chromogranin A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHGA
Entrez