Choline kinase alpha Antibody - BSA Free

Western Blot: Choline kinase alpha Antibody [NBP1-56668] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Western Blot: Choline kinase alpha Antibody [NBP1-56668] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Human Liver

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Choline kinase alpha Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CHKA(choline kinase alpha) The peptide sequence was selected from the middle region of CHKA (NP_001268). Peptide sequence LESVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHKA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Choline kinase alpha Antibody - BSA Free

• CHETK-alpha
• CHK
• choline kinase alpha
• choline kinase
• CK
• CKIethanolamine kinase
• EC 2.7.1.32
• EC 2.7.1.82
• EK
• Ethanolamine kinase;

Background

The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. CHKA is the initial enzyme in the sequence and may play a regulatory role. It also catalyzes the phosphorylation of ethanolamine.The major pathway for the biosynthesis of phosphatidylcholine occurs via the CDP-choline pathway. The protein encoded by this gene is the initial enzyme in the sequence and may play a regulatory role. The encoded protein also catalyzes the phosphorylation of ethanolamine. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHKA
• Entrez:
  • 1119(Human)
  • 12660(Mouse)
  • 29194(Rat)
• Uniprot:
  • P35790(Human)