Chimaerin 2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Chimaerin 2 Antibody - BSA Free (NBP3-21241) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHT |
| Predicted Species |
Mouse (92%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHN2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Chimaerin 2 Antibody - BSA Free
Background
Chimaerin 2 is a protein expressed in the brain and pancreas with two isoforms, measuring 468 and 332 amino acids in length with weights of approximately 54 and 38 kDa respectively. Chimaerin 2 functions as a GTP-ase activating protein for p21-rac, and a deficiency in this protein could lead to tumor progression. Current studies are being done on several diseases and disorders related to this protein including b-cell lymphomas, schizophrenia, sleeping sickness, insulin resistance, diabetic retinopathy, malignant glioma, nephropathy, spasticity, astrocytoma, and breast cancer. Chimaerin 2 has also been shown to have interactions with BAG6, NCK1, RAC1, ERBB3, and EIF3C in pathways such as the Rho GTPase cycle, signal transduction, and regulations of RAC1 activity pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Chimaerin 2 Antibody (NBP3-21241) (0)
There are no publications for Chimaerin 2 Antibody (NBP3-21241).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Chimaerin 2 Antibody (NBP3-21241) (0)
There are no reviews for Chimaerin 2 Antibody (NBP3-21241).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Chimaerin 2 Antibody (NBP3-21241) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Chimaerin 2 Products
Research Areas for Chimaerin 2 Antibody (NBP3-21241)
Find related products by research area.
|
Blogs on Chimaerin 2