ARHGAP1 Antibody

Images

 
Genetic Strategies: Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85724] - Staining of human hippocampus shows positivity in neuropil.
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in human cell line MCF-7.
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse brain shows neuronal staining in lateral paragigantocellular nucleus.
Immunocytochemistry/ Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse cingulate cortex shows cytoplasmic immunoreactivity in neurons.
Immunocytochemistry/ Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse dentate gyrus shows immunoreactivity in polymorph layer.
Immunocytochemistry/ Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse motor trigeminal nucleus shows positivity in neuronal cells bodies and processes.
Immunocytochemistry/ Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Staining of mouse thalamus shows positivity in neurons of the anterodorsal thalamic nucleus.
Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85724] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

ARHGAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLS
Specificity
Specificity of human, mouse, rat ARHGAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGAP1 Protein (NBP1-85724PEP)
Publications
Read Publication using NBP1-85724.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP1 Antibody

  • ARHGAP1
  • CDC42 GTPase-activating protein
  • CDC42GAP
  • CDC42GAPp50-RhoGAP
  • GTPase-activating protein rhoOGAP
  • p50rhoGAP
  • Rho GTPase activating protein 1
  • rho GTPase-activating protein 1
  • RhoGAP
  • RHOGAP1Cdc42GAP
  • Rho-related small GTPase protein activator
  • Rho-type GTPase-activating protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB300-917
Species: Hu, Mu
Applications: IHC, IHC-P, IF
NBP2-15602
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49172
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-94863
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7548
Species: Hu
Applications: IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ARHGAP1 Antibody (NBP1-85724)(1)

Reviews for ARHGAP1 Antibody (NBP1-85724) (0)

There are no reviews for ARHGAP1 Antibody (NBP1-85724). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARHGAP1 Antibody (NBP1-85724) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGAP1 Products

Bioinformatics Tool for ARHGAP1 Antibody (NBP1-85724)

Discover related pathways, diseases and genes to ARHGAP1 Antibody (NBP1-85724). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP1 Antibody (NBP1-85724)

Discover more about diseases related to ARHGAP1 Antibody (NBP1-85724).
 

Pathways for ARHGAP1 Antibody (NBP1-85724)

View related products by pathway.

Blogs on ARHGAP1

There are no specific blogs for ARHGAP1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP1
Entrez
Uniprot