Chimaerin 2 Antibody


Immunohistochemistry-Paraffin: Chimaerin 2 Antibody [NBP1-90108] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Chimaerin 2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
Specificity of human Chimaerin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Chimaerin 2 Protein (NBP1-90108PEP)
Read Publication using
NBP1-90108 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26315110).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Chimaerin 2 Antibody

  • ARHGAP3beta chimerin
  • BCH
  • beta-chimaerin
  • beta-chimerin
  • chimerin (chimaerin) 2
  • MGC138360
  • Rho GTPase-activating protein 3
  • rho-GTPase-activating protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Chimaerin 2 Antibody (NBP1-90108)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Chimaerin 2 Antibody (NBP1-90108) (0)

There are no reviews for Chimaerin 2 Antibody (NBP1-90108). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chimaerin 2 Antibody (NBP1-90108) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Chimaerin 2 Products

Bioinformatics Tool for Chimaerin 2 Antibody (NBP1-90108)

Discover related pathways, diseases and genes to Chimaerin 2 Antibody (NBP1-90108). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chimaerin 2 Antibody (NBP1-90108)

Discover more about diseases related to Chimaerin 2 Antibody (NBP1-90108).

Pathways for Chimaerin 2 Antibody (NBP1-90108)

View related products by pathway.

Blogs on Chimaerin 2

There are no specific blogs for Chimaerin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Chimaerin 2 Antibody and receive a gift card or discount.


Gene Symbol CHN2