Chemerin Antibody

Images

 
Western Blot: Chemerin Antibody [H00005919-D01P] - Analysis of RARRES2 expression in mouse testis.
Western Blot: Chemerin Antibody [H00005919-D01P] - Analysis of RARRES2 expression in transfected 293T cell line by RARRES2 polyclonal antibody.Lane 1: RARRES2 transfected lysate(18.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Chemerin Antibody Summary

Immunogen
RARRES2 (NP_002880.1, 1 a.a. - 163 a.a.) full-length human protein. MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Specificity
RARRES2 - retinoic acid receptor responder (tazarotene induced) 2,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RARRES2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Chemerin Antibody

  • Chemerin
  • RARRES2
  • RAR-responsive protein TIG2
  • retinoic acid receptor responder (tazarotene induced) 2
  • retinoic acid receptor responder protein 2
  • Tazarotene-induced gene 2 protein
  • TIG-2
  • TIG2HP10433

Background

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43233
Species: Mu
Applications: Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-23795
Species: Hu, Rt
Applications: WB
AF4254
Species: Hu
Applications: WB, IHC, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-27422
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00005919-D01P
Species: Hu, Mu
Applications: WB

Publications for Chemerin Antibody (H00005919-D01P) (0)

There are no publications for Chemerin Antibody (H00005919-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chemerin Antibody (H00005919-D01P) (0)

There are no reviews for Chemerin Antibody (H00005919-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Chemerin Antibody (H00005919-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Chemerin Products

Bioinformatics Tool for Chemerin Antibody (H00005919-D01P)

Discover related pathways, diseases and genes to Chemerin Antibody (H00005919-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Chemerin Antibody (H00005919-D01P)

Discover more about diseases related to Chemerin Antibody (H00005919-D01P).
 

Pathways for Chemerin Antibody (H00005919-D01P)

View related products by pathway.

PTMs for Chemerin Antibody (H00005919-D01P)

Learn more about PTMs related to Chemerin Antibody (H00005919-D01P).

Blogs on Chemerin

There are no specific blogs for Chemerin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chemerin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARRES2
Entrez
Uniprot