Chemerin Antibody Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
RARRES2 (NP_002880.1, 1 a.a. - 163 a.a.) full-length human protein. MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS |
| Specificity |
RARRES2 - retinoic acid receptor responder (tazarotene induced) 2, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
RARRES2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Chemerin Antibody
Background
Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES2 is thought to act as a cell surface receptor. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Publications for Chemerin Antibody (H00005919-B01P) (0)
There are no publications for Chemerin Antibody (H00005919-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Chemerin Antibody (H00005919-B01P) (0)
There are no reviews for Chemerin Antibody (H00005919-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Chemerin Antibody (H00005919-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Chemerin Products
Blogs on Chemerin