Ces2a Antibody


Western Blot: Ces2a Antibody [NBP1-91620] - NIH-3T3 cells lysate, concentration 1.25ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

Ces2a Antibody Summary

Synthetic peptide directed towards the middle region of human CES6. Peptide sequence MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CES6 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Ces2a Antibody

  • carboxylesterase 2A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Mu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Ces2a Antibody (NBP1-91620) (0)

There are no publications for Ces2a Antibody (NBP1-91620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ces2a Antibody (NBP1-91620) (0)

There are no reviews for Ces2a Antibody (NBP1-91620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ces2a Antibody (NBP1-91620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Ces2a Products

Array NBP1-91620

Bioinformatics Tool for Ces2a Antibody (NBP1-91620)

Discover related pathways, diseases and genes to Ces2a Antibody (NBP1-91620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for Ces2a Antibody (NBP1-91620)

Learn more about PTMs related to Ces2a Antibody (NBP1-91620).

Blogs on Ces2a

There are no specific blogs for Ces2a, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Nrf2 Antibody

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Ces2a Antibody and receive a gift card or discount.


Gene Symbol CES6