Metallothionein-2A Antibody (6G2)

Images

 
Immunocytochemistry/ Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Metallothionein-2A Antibody (6G2) Summary

Immunogen
MT2A (NP_005944.1, 1 a.a. - 61 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
MT2A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.
Positive Control
Metallothionein-2A Lysate (NBP2-65832)
Publications
Read Publications using H00004502-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Metallothionein-2A Antibody (6G2)

  • CES1
  • metallothionein 2A
  • metallothionein-2
  • metallothionein-2A
  • Metallothionein-II
  • MT-2
  • MT2metallothionein-II
  • MT-II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28912
Species: Rt
Applications: WB, PEP-ELISA
H00004498-R01
Species: Hu
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Metallothionein-2A Antibody (H00004502-M01)(2)

Reviews for Metallothionein-2A Antibody (H00004502-M01) (0)

There are no reviews for Metallothionein-2A Antibody (H00004502-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Metallothionein-2A Antibody (H00004502-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Metallothionein-2A Antibody (H00004502-M01)

Discover related pathways, diseases and genes to Metallothionein-2A Antibody (H00004502-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Metallothionein-2A Antibody (H00004502-M01)

Discover more about diseases related to Metallothionein-2A Antibody (H00004502-M01).
 

Pathways for Metallothionein-2A Antibody (H00004502-M01)

View related products by pathway.

PTMs for Metallothionein-2A Antibody (H00004502-M01)

Learn more about PTMs related to Metallothionein-2A Antibody (H00004502-M01).

Blogs on Metallothionein-2A

There are no specific blogs for Metallothionein-2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Metallothionein-2A Antibody (6G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MT2A
Uniprot