CEP70 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CEP70 Antibody [NBP1-88593] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CEP70 Antibody [NBP1-88593] - Staining of human kidney.
Immunohistochemistry-Paraffin: CEP70 Antibody [NBP1-88593] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: CEP70 Antibody [NBP1-88593] - Staining of human colon, kidney, liver and testis using Anti-CEP70 antibody NBP1-88593 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: CEP70 Antibody [NBP1-88593] - Staining of human liver.
Immunohistochemistry-Paraffin: CEP70 Antibody [NBP1-88593] - Staining of human colon.
Immunohistochemistry-Paraffin: CEP70 Antibody [NBP1-88593] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

CEP70 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIHNPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CEP70 Protein (NBP1-88593PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEP70 Antibody

  • BITEFLJ13036
  • centrosomal protein 70kDa
  • centrosomal protein of 70 kDa
  • Cep70
  • p10-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CEP70 Antibody (NBP1-88593) (0)

There are no publications for CEP70 Antibody (NBP1-88593).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEP70 Antibody (NBP1-88593) (0)

There are no reviews for CEP70 Antibody (NBP1-88593). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEP70 Antibody (NBP1-88593) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP70