CEACAM5/CD66e Antibody

Images

 
Western Blot: CEACAM5/CD66e Antibody [NBP1-85742] - Analysis in human colon tissue.
Immunocytochemistry/ Immunofluorescence: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human cell line HaCaT shows localization to plasma membrane.
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Immunohistochemical staining of human appendix shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CEACAM5/CD66e Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEACAM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CEACAM5/CD66e Antibody

  • Carcinoembryonic antigen
  • carcinoembryonic antigen-related cell adhesion molecule 5
  • CD66e antigen
  • CD66e
  • CEA
  • CEACAM5
  • CEACAM-5
  • CEACD66e
  • DKFZp781M2392
  • Meconium antigen 100

Background

Carcino Embryonic Antigen (CEA) is synthesised during development in the fetal gut, and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. Antibodies to CEA are useful in identifying the origin of various metastatic adenocarcinomas and in distinguishing pulmonary adenocarcinomas (60 to 70% are CEA+) from pleural mesotheliomas (rarely or weakly CEA+).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB3934
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CEACAM5/CD66e Antibody (NBP1-85742) (0)

There are no publications for CEACAM5/CD66e Antibody (NBP1-85742).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM5/CD66e Antibody (NBP1-85742) (0)

There are no reviews for CEACAM5/CD66e Antibody (NBP1-85742). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CEACAM5/CD66e Antibody (NBP1-85742) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEACAM5/CD66e Products

Bioinformatics Tool for CEACAM5/CD66e Antibody (NBP1-85742)

Discover related pathways, diseases and genes to CEACAM5/CD66e Antibody (NBP1-85742). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEACAM5/CD66e Antibody (NBP1-85742)

Discover more about diseases related to CEACAM5/CD66e Antibody (NBP1-85742).
 

Pathways for CEACAM5/CD66e Antibody (NBP1-85742)

View related products by pathway.

PTMs for CEACAM5/CD66e Antibody (NBP1-85742)

Learn more about PTMs related to CEACAM5/CD66e Antibody (NBP1-85742).
 

Research Areas for CEACAM5/CD66e Antibody (NBP1-85742)

Find related products by research area.

Blogs on CEACAM5/CD66e

There are no specific blogs for CEACAM5/CD66e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEACAM5/CD66e Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM5
Entrez