CEACAM5/CD66e Antibody - BSA Free

Staining of human cell line HaCaT shows localization to plasma membrane.

Western Blot: CEACAM5/CD66e Antibody [NBP1-85742] - Analysis in human colon tissue.

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human colorectal cancer shows strong membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human colon shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody [NBP1-85742] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CEACAM5/CD66e Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CEACAM5/CD66e Antibody - BSA Free (NBP1-85742) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CEACAM5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 -1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CEACAM5/CD66e Antibody - BSA Free

• Carcinoembryonic antigen
• carcinoembryonic antigen-related cell adhesion molecule 5
• CD66e antigen
• CD66e
• CEA
• CEACAM5
• CEACAM-5
• CEACD66e
• DKFZp781M2392
• Meconium antigen 100

Background

Carcino Embryonic Antigen (CEA) is synthesised during development in the fetal gut, and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. Antibodies to CEA are useful in identifying the origin of various metastatic adenocarcinomas and in distinguishing pulmonary adenocarcinomas (60 to 70% are CEA+) from pleural mesotheliomas (rarely or weakly CEA+).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CEACAM5
• Entrez:
  • 1048(Human)