CDS1 Antibody

Images

 
Western Blot: CDS1 Antibody [NBP1-59495] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CDS1(CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1) The peptide sequence was selected from the middle region of CDS1. Peptide sequence VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CDS1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CDS1 Antibody

  • CDP-DAG synthase 1
  • CDP-DG synthase 1
  • CDP-DG synthetase 1
  • CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
  • CDP-diacylglycerol synthase 1
  • CDP-diglyceride pyrophosphorylase 1
  • CDP-diglyceride synthase 1
  • CDP-diglyceride synthetase 1
  • CDS 1
  • CDS
  • CTP:phosphatidate cytidylyltransferase 1
  • EC 2.7.7.41
  • phosphatidate cytidylyltransferase 1

Background

Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-86435
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81784
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CDS1 Antibody (NBP1-59495) (0)

There are no publications for CDS1 Antibody (NBP1-59495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDS1 Antibody (NBP1-59495) (0)

There are no reviews for CDS1 Antibody (NBP1-59495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDS1 Antibody (NBP1-59495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDS1 Products

Bioinformatics Tool for CDS1 Antibody (NBP1-59495)

Discover related pathways, diseases and genes to CDS1 Antibody (NBP1-59495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDS1 Antibody (NBP1-59495)

Discover more about diseases related to CDS1 Antibody (NBP1-59495).
 

Pathways for CDS1 Antibody (NBP1-59495)

View related products by pathway.

PTMs for CDS1 Antibody (NBP1-59495)

Learn more about PTMs related to CDS1 Antibody (NBP1-59495).
 

Research Areas for CDS1 Antibody (NBP1-59495)

Find related products by research area.

Blogs on CDS1

There are no specific blogs for CDS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDS1
Uniprot