CDKL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDKL2 Antibody [NBP1-82873] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome.
Immunohistochemistry-Paraffin: CDKL2 Antibody [NBP1-82873] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDKL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDKL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDKL2 Protein (NBP1-82873PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDKL2 Antibody

  • CDC2-related kinase
  • cyclin-dependent kinase-like 2 (CDC2-related kinase)
  • cyclin-dependent kinase-like 2
  • EC 2.7.11
  • EC 2.7.11.22
  • KKIAMRE
  • p56 KKIAMRE protein kinase
  • P56
  • Protein kinase p56 KKIAMRE
  • serine/threonine protein kinase KKIAMRE
  • Serine/threonine-protein kinase KKIAMRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7500
Species: Hu
Applications: WB, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82873
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CDKL2 Antibody (NBP1-82873) (0)

There are no publications for CDKL2 Antibody (NBP1-82873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL2 Antibody (NBP1-82873) (0)

There are no reviews for CDKL2 Antibody (NBP1-82873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDKL2 Antibody (NBP1-82873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDKL2 Products

Bioinformatics Tool for CDKL2 Antibody (NBP1-82873)

Discover related pathways, diseases and genes to CDKL2 Antibody (NBP1-82873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL2 Antibody (NBP1-82873)

Discover more about diseases related to CDKL2 Antibody (NBP1-82873).
 

Pathways for CDKL2 Antibody (NBP1-82873)

View related products by pathway.

PTMs for CDKL2 Antibody (NBP1-82873)

Learn more about PTMs related to CDKL2 Antibody (NBP1-82873).
 

Research Areas for CDKL2 Antibody (NBP1-82873)

Find related products by research area.

Blogs on CDKL2

There are no specific blogs for CDKL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL2