CDK2AP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CDK2AP1 Antibody [NBP2-56924] - Staining of human cell line BJ shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDK2AP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDK2AP1 Antibody - BSA Free (NBP2-56924) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDK2AP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CDK2AP1 Recombinant Protein Antigen (NBP2-56924PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDK2AP1 Antibody - BSA Free

• CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1
• CDKAP1
• cyclin-dependent kinase 2 associated protein 1
• Deleted in oral cancer 1
• Deleted in oral cancer-1
• doc-1
• DOC1Putative oral cancer suppressor
• DORC1
• p12DOC-1
• ST19

Background

CDK2AP1 is encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK2AP1