CDK2AP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDK2AP1 Antibody [NBP2-56924] - Staining of human cell line BJ shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDK2AP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Specificity
Specificity of human CDK2AP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDK2AP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDK2AP1 Recombinant Protein Antigen (NBP2-56924PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CDK2AP1 Antibody

  • CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1
  • CDKAP1
  • cyclin-dependent kinase 2 associated protein 1
  • Deleted in oral cancer 1
  • Deleted in oral cancer-1
  • doc-1
  • DOC1Putative oral cancer suppressor
  • DORC1
  • p12DOC-1
  • ST19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-64870
Species: Hu
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61889
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-67820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NBP2-56924
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for CDK2AP1 Antibody (NBP2-56924) (0)

There are no publications for CDK2AP1 Antibody (NBP2-56924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK2AP1 Antibody (NBP2-56924) (0)

There are no reviews for CDK2AP1 Antibody (NBP2-56924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDK2AP1 Antibody (NBP2-56924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDK2AP1 Antibody (NBP2-56924)

Discover related pathways, diseases and genes to CDK2AP1 Antibody (NBP2-56924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK2AP1 Antibody (NBP2-56924)

Discover more about diseases related to CDK2AP1 Antibody (NBP2-56924).
 

Pathways for CDK2AP1 Antibody (NBP2-56924)

View related products by pathway.

PTMs for CDK2AP1 Antibody (NBP2-56924)

Learn more about PTMs related to CDK2AP1 Antibody (NBP2-56924).
 

Research Areas for CDK2AP1 Antibody (NBP2-56924)

Find related products by research area.

Blogs on CDK2AP1

There are no specific blogs for CDK2AP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK2AP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK2AP1