Cdc27 Antibody

Images

 
Western Blot: Cdc27 Antibody [NBP1-89095] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-111
Immunocytochemistry/ Immunofluorescence: Cdc27 Antibody [NBP1-89095] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Cdc27 Antibody [NBP1-89095] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cdc27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cdc27 Protein (NBP1-89095PEP)
Publications
Read Publication using NBP1-89095.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cdc27 Antibody

  • ANAPC3CDC27 homolog
  • anaphase promoting complex subunit 3
  • Anaphase-promoting complex subunit 3
  • anaphase-promoting complex, protein 3
  • APC 3
  • APC3cell division cycle 27
  • CDC27Hs
  • cell division cycle 27 homolog (S. cerevisiae)
  • cell division cycle protein 27 homolog
  • D0S1430E
  • D17S978E
  • HNUC
  • H-NUC
  • nuc2 homolog
  • NUC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-20389
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77376
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-01128
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cdc27 Antibody (NBP1-89095)(1)

Reviews for Cdc27 Antibody (NBP1-89095) (0)

There are no reviews for Cdc27 Antibody (NBP1-89095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cdc27 Antibody (NBP1-89095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdc27 Products

Bioinformatics Tool for Cdc27 Antibody (NBP1-89095)

Discover related pathways, diseases and genes to Cdc27 Antibody (NBP1-89095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdc27 Antibody (NBP1-89095)

Discover more about diseases related to Cdc27 Antibody (NBP1-89095).
 

Pathways for Cdc27 Antibody (NBP1-89095)

View related products by pathway.

PTMs for Cdc27 Antibody (NBP1-89095)

Learn more about PTMs related to Cdc27 Antibody (NBP1-89095).
 

Research Areas for Cdc27 Antibody (NBP1-89095)

Find related products by research area.

Blogs on Cdc27

There are no specific blogs for Cdc27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdc27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC27