CDK2AP2 Antibody

Images

 
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in NIH/3T3.
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in PC-12.
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Hela S3 NE.
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Raw 264.7.
Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in transfected 293T cell line by CDK2AP2 polyclonal antibody. Lane 1: CDK2AP2 transfected lysate(13.86 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDK2AP2 Antibody Summary

Immunogen
CDK2AP2 (AAH02850, 1 a.a. - 126 a.a.) full-length human protein. MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Specificity
CDK2AP2 - CDK2-associated protein 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CDK2AP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK2AP2 Antibody

  • CDK2-associated protein 2tumor suppressor deleted in oral cancer related 1
  • cyclin-dependent kinase 2 associated protein 2
  • DOC1R
  • DOC-1Rcyclin-dependent kinase 2-associated protein 2
  • DOC-1-related protein
  • FLJ10636
  • p14
  • tumor suppressor deleted in oral cancer-related 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-59875
Species: Hu
Applications: WB
NBP2-20235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00010263-B01P
Species: Hu, Mu, Rt
Applications: WB

Publications for CDK2AP2 Antibody (H00010263-B01P) (0)

There are no publications for CDK2AP2 Antibody (H00010263-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK2AP2 Antibody (H00010263-B01P) (0)

There are no reviews for CDK2AP2 Antibody (H00010263-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK2AP2 Antibody (H00010263-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CDK2AP2 Products

Bioinformatics Tool for CDK2AP2 Antibody (H00010263-B01P)

Discover related pathways, diseases and genes to CDK2AP2 Antibody (H00010263-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK2AP2 Antibody (H00010263-B01P)

Discover more about diseases related to CDK2AP2 Antibody (H00010263-B01P).
 

Pathways for CDK2AP2 Antibody (H00010263-B01P)

View related products by pathway.

Blogs on CDK2AP2

There are no specific blogs for CDK2AP2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK2AP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK2AP2
Entrez
Uniprot