CDK2AP1 Antibody

Images

 
Western Blot: CDK2AP1 Antibody [H00008099-B02P] - Analysis of CDK2AP1 expression in transfected 293T cell line by CDK2AP1 polyclonal antibody. Lane 1: CDK2AP1 transfected lysate(12.40 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDK2AP1 Antibody Summary

Immunogen
CDK2AP1 (AAH34717.1, 1 a.a. - 115 a.a.) full-length human protein. MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CDK2AP1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDK2AP1 Antibody

  • CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1
  • CDKAP1
  • cyclin-dependent kinase 2 associated protein 1
  • Deleted in oral cancer 1
  • Deleted in oral cancer-1
  • doc-1
  • DOC1Putative oral cancer suppressor
  • DORC1
  • p12DOC-1
  • ST19

Background

The protein encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-49672
Species: Hu
Applications: IHC
H00057804-M01A
Species: Hu
Applications: WB, ELISA
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77157
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89095
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
H00008099-B02P
Species: Hu
Applications: WB

Publications for CDK2AP1 Antibody (H00008099-B02P) (0)

There are no publications for CDK2AP1 Antibody (H00008099-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDK2AP1 Antibody (H00008099-B02P) (0)

There are no reviews for CDK2AP1 Antibody (H00008099-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDK2AP1 Antibody (H00008099-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDK2AP1 Products

Bioinformatics Tool for CDK2AP1 Antibody (H00008099-B02P)

Discover related pathways, diseases and genes to CDK2AP1 Antibody (H00008099-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDK2AP1 Antibody (H00008099-B02P)

Discover more about diseases related to CDK2AP1 Antibody (H00008099-B02P).
 

Pathways for CDK2AP1 Antibody (H00008099-B02P)

View related products by pathway.

PTMs for CDK2AP1 Antibody (H00008099-B02P)

Learn more about PTMs related to CDK2AP1 Antibody (H00008099-B02P).
 

Research Areas for CDK2AP1 Antibody (H00008099-B02P)

Find related products by research area.

Blogs on CDK2AP1

There are no specific blogs for CDK2AP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDK2AP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK2AP1
Uniprot