CD83 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining in human tonsil and endometrium tissues . Corresponding CD83 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: CD83 Antibody [NBP2-38485] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human colon shows moderate positivity in nuclear membrane in lymphoid cells.

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human endometrium shows moderate positivity in nuclear membrane in lymphoid cells.

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human lung shows moderate membranous positivity in macrophages.

Immunohistochemistry-Paraffin: CD83 Antibody [NBP2-38485] - Staining of human tonsil shows moderate positivity in nuclear membrane in lymphoid cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD83 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD83 Antibody - BSA Free (NBP2-38485) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD83
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CD83 Protein (NBP2-38485PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD83 Antibody - BSA Free

• B-cell activation protein
• BL11
• BL11CD83 antigen
• CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
• CD83 molecule
• CD83
• Cell surface protein HB15
• cell-surface glycoprotein
• HB15
• HB15hCD83

Background

CD83 is a 43 kD single chain type I glycoprotein also known as HB15. A member of the immunoglobulin superfamily, CD83 is expressed on a subset of dendritic cells, Langerhans cells, and weakly on activated lymphocytes. Although CD83 is thought to play a role in antigen presentation and/or lymphocyte activation, the precise function of this protein is unknown. CD83 is considered to be a useful marker for mature dendritic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD83
• Uniprot:
  • Q01151()