CD53 Antibody


Immunohistochemistry-Paraffin: CD53 Antibody [NBP2-14464] Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CD53 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPAS CPSDRKVEGCYAKARLWFHS
Specificity of human CD53 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD53 Protein (NBP2-14464PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD53 Antibody

  • antigen MOX44 identified by monoclonal MRC-OX44
  • CD53 antigentetraspanin-25
  • CD53 glycoprotein
  • CD53 molecule
  • CD53 tetraspan antigen
  • CD53
  • cell surface antigen
  • Cell surface glycoprotein CD53
  • MOX44
  • MOX44transmembrane glycoprotein
  • Tetraspanin-25
  • TSPAN25
  • tspan-25
  • TSPAN25leukocyte surface antigen CD53


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, ICC/IF, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC-P, ICC
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Species: Hu
Applications: Flow, IP, CyTOF-ready
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Mu
Species: Hu
Applications: WB, ELISA, IHC
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD53 Antibody (NBP2-14464) (0)

There are no publications for CD53 Antibody (NBP2-14464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD53 Antibody (NBP2-14464) (0)

There are no reviews for CD53 Antibody (NBP2-14464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD53 Antibody (NBP2-14464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD53 Products

Bioinformatics Tool for CD53 Antibody (NBP2-14464)

Discover related pathways, diseases and genes to CD53 Antibody (NBP2-14464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD53 Antibody (NBP2-14464)

Discover more about diseases related to CD53 Antibody (NBP2-14464).

Pathways for CD53 Antibody (NBP2-14464)

View related products by pathway.

PTMs for CD53 Antibody (NBP2-14464)

Learn more about PTMs related to CD53 Antibody (NBP2-14464).

Research Areas for CD53 Antibody (NBP2-14464)

Find related products by research area.

Blogs on CD53.

CD81/TAPA1: I'm on Tapa the Cell
Target of the antiproliferative 1 (TAPA1), also known as CD81, is found in the plasma membrane in lymphocytes and plays an important role in the regulation of lymphoma cell growth. This transmembrane 4 superfamily (TM4SF) protein is primarily found on...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD53 Antibody and receive a gift card or discount.


Gene Symbol CD53