CD53 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD53 Antibody [NBP2-14464] Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD53 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD53 Antibody - BSA Free (NBP2-14464) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD53
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD53 Protein (NBP2-14464PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD53 Antibody - BSA Free

• antigen MOX44 identified by monoclonal MRC-OX44
• CD53 antigentetraspanin-25
• CD53 glycoprotein
• CD53 molecule
• CD53 tetraspan antigen
• CD53
• cell surface antigen
• Cell surface glycoprotein CD53
• MOX44
• MOX44transmembrane glycoprotein
• Tetraspanin-25
• TSPAN25
• Tspan-25
• TSPAN25leukocyte surface antigen CD53

Background

The antibody reacts with CD53 antigen, a glycoprotein of 32-40 kDa belonging to the tetraspans family (TM4SF). CD53 antigen is exclusivelly expressed on leucocytes (not present on platelets, red blood cells and non-hematopoietic cells). CD53 is important for signal transduction. CD53 cross-linking promotes activation of human B cells and rat macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD53