Tetraspanin-4 Antibody - BSA Free

Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: Tetraspanin-4 Antibody [NBP1-59438] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - GST-Teraspanin EC2 Expressed in E. coli.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Tetraspanin-4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405). The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSPAN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Tetraspanin-4 Antibody - BSA Free

• NAG2
• Novel antigen 2
• TETRASPAN
• tetraspanin 4
• Tetraspanin-4
• TM4SF7
• Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF
• TSPAN4
• TSPAN-4

Background

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tetraspanin-4 Antibody (NBP1-59438)(2)

Publications using NBP1-59438

• Dong Y, Tang X, Zhao W, Liu P et Al. TSPAN4 influences glioblastoma progression through regulating EGFR stability iScience 2024-08-07 [PMID: 39108703]
• Wu L, Yang S, Li H et al. TSPAN4-positive migrasome derived from retinal pigmented epithelium cells contributes to the development of proliferative vitreoretinopathy Journal of nanobiotechnology 2022-12-09 [PMID: 36494806] (WB, IHC, ICC/IF, Human, Rat)

Bioinformatics

• Gene Symbol: TSPAN4
• Entrez:
  • 7106(Human)
• Uniprot:
  • O14817(Human)