Uroplakin Ib Antibody

Images

 
Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - UPK 1b positive staining (brown) of murine bladder epithelium, 4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB ...read more
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uroplakin Ib Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPK1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Uroplakin Ib antibody validated for IHC-P from a verified customer review.
Control Peptide
Uroplakin Ib Protein (NBP1-80656PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-80656 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review. Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uroplakin Ib Antibody

  • tetraspanin-20
  • TSPAN20
  • tspan-20
  • TSPAN20tetraspan
  • UP1b
  • UPIB
  • UPK1
  • UPK1B
  • Uroplakin 1B
  • Uroplakin Ib
  • uroplakin-1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-86873
Species: Hu
Applications: IHC, IHC-P
NBP2-79733
Species: Ca, Hu
Applications: ELISA, IHC, IHC-P, PA
NBP2-79733
Species: Ca, Hu
Applications: ELISA, IHC, IHC-P, PA
NB110-59086
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBL1-15012
Species: Hu
Applications: WB
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NB500-393
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-Fr, IP, WB
NBP1-86847
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-80656
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Uroplakin Ib Antibody (NBP1-80656) (0)

There are no publications for Uroplakin Ib Antibody (NBP1-80656).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Uroplakin Ib Antibody (NBP1-80656) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-80656:
Filter by Applications
Immunohistochemistry-Paraffin
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Uroplakin Ib NBP1-80656
Enlarge
5
reviewed by:
holly poling
Immunohistochemistry-Paraffin Mouse 01/17/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedBladder tissue
SpeciesMouse
LotA103547

Comments

Comments4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB kit used.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uroplakin Ib Antibody (NBP1-80656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uroplakin Ib Products

Bioinformatics Tool for Uroplakin Ib Antibody (NBP1-80656)

Discover related pathways, diseases and genes to Uroplakin Ib Antibody (NBP1-80656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uroplakin Ib Antibody (NBP1-80656)

Discover more about diseases related to Uroplakin Ib Antibody (NBP1-80656).
 

Pathways for Uroplakin Ib Antibody (NBP1-80656)

View related products by pathway.

PTMs for Uroplakin Ib Antibody (NBP1-80656)

Learn more about PTMs related to Uroplakin Ib Antibody (NBP1-80656).
 

Research Areas for Uroplakin Ib Antibody (NBP1-80656)

Find related products by research area.

Blogs on Uroplakin Ib

There are no specific blogs for Uroplakin Ib, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

holly poling
01/17/2020
Application: Immunohistochemistry-Paraffin
Species: Mouse

Bioinformatics

Gene Symbol UPK1B
Entrez