Uroplakin Ib Antibody

Images

 
Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis of Uroplakin Ib antibody. Lane M: Protein marker Lane 1: UMUC1 cell lysates 30 ug Lane 2: RT112 cell lysates 30 ug. Image from verified customer review.
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - UPK 1b positive staining (brown) of murine bladder epithelium, 4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB ...read more
Western Blot: Uroplakin Ib Antibody [NBP1-80656] - Analysis in control (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Uroplakin Ib Antibody [NBP1-80656] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uroplakin Ib Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UPK1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Uroplakin Ib antibody validated for IHC-P from a verified customer review.
Control Peptide
Uroplakin Ib Protein (NBP1-80656PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-80656 in the following applications:

Publications
Read Publications using
NBP1-80656 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review. Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uroplakin Ib Antibody

  • tetraspanin-20
  • TSPAN20
  • tspan-20
  • TSPAN20tetraspan
  • UP1b
  • UPIB
  • UPK1
  • UPK1B
  • Uroplakin 1B
  • Uroplakin Ib
  • uroplakin-1b

Background

UPK1B - uroplakin 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Uroplakin Ib Antibody (NBP1-80656)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for Uroplakin Ib Antibody (NBP1-80656) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-80656:
Filter by Applications
WB
(1)
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Uroplakin Ib NBP1-80656
Enlarge
5
reviewed by:
Ming Lu
WB Human 01/20/2023
View

Summary

ApplicationWestern Blot
Sample TestedBladder cancer cell line lysate
SpeciesHuman
Lot000042032
Immunohistochemistry-Paraffin Uroplakin Ib NBP1-80656
Enlarge
5
reviewed by:
Verified Customer
IHC-P Mouse 01/17/2020
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedBladder tissue
SpeciesMouse
LotA103547

Comments

Comments4% paraformaldehyde fixation, paraffin embedding, and pH 6 HEIR retrieval method and DAB kit used.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uroplakin Ib Antibody (NBP1-80656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uroplakin Ib Products

Research Areas for Uroplakin Ib Antibody (NBP1-80656)

Find related products by research area.

Blogs on Uroplakin Ib

There are no specific blogs for Uroplakin Ib, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Ming Lu
01/20/2023
Application: WB
Species: Human

Verified Customer
01/17/2020
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol UPK1B
Entrez