CD47 Antibody

Images

 
Immunohistochemistry-Paraffin: CD47 Antibody [NBP2-32031] - Staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD47 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD47 Protein (NBP2-32031PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-32031 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD47 Antibody

  • antigen identified by monoclonal 1D8
  • Antigenic surface determinant protein OA3
  • CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
  • CD47 antigen
  • CD47 glycoprotein
  • CD47 molecule
  • CD47
  • IAP
  • IAPintegrin associated protein
  • Integrin-associated protein
  • leukocyte surface antigen CD47
  • MER6integrin-associated signal transducer
  • OA3
  • Protein MER6
  • Rh-related antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB7307
Species: Rt
Applications: WB, Flow, CyTOF-ready, Neut
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37387
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56548
Species: Hu
Applications: WB, ICC/IF
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for CD47 Antibody (NBP2-32031) (0)

There are no publications for CD47 Antibody (NBP2-32031).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CD47 Antibody (NBP2-32031) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP2-32031:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
IHC-P Human 10/28/2015
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman lymph node
SpeciesHuman
LotR40964

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD47 Antibody (NBP2-32031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD47 Products

Bioinformatics Tool for CD47 Antibody (NBP2-32031)

Discover related pathways, diseases and genes to CD47 Antibody (NBP2-32031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD47 Antibody (NBP2-32031)

Discover more about diseases related to CD47 Antibody (NBP2-32031).
 

Pathways for CD47 Antibody (NBP2-32031)

View related products by pathway.

PTMs for CD47 Antibody (NBP2-32031)

Learn more about PTMs related to CD47 Antibody (NBP2-32031).
 

Research Areas for CD47 Antibody (NBP2-32031)

Find related products by research area.

Blogs on CD47

There are no specific blogs for CD47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Anonymous
10/28/2015
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol CD47
Entrez
Uniprot