CD46 Antibody (6D2A4) Summary
| Description |
Novus Biologicals Rabbit CD46 Antibody (6D2A4) (NBP3-15618) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD46 (P15529). MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCP |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CD46 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CD46 Antibody (6D2A4)
Background
CD46 is one of the membrane complement regulatory proteins. CD46 possesses C3b-binding and factor I cofactor activities which play important roles in regulation of complement activation pathway. CD46 is widely distributed on blood cells, endothelial cells, epithelial cells and tumor cell lines. CD46 exists as many isoforms in a variety of tissues. The antigen has a broad distribution and is present on leukocytes, platelets, endothelial cells, epithelial cells and fibroblasts. It is strongly expressed on salivary gland ducts and kidney ducts, moderately on lymphocytes and endothelium, and weakly on interstitial tissues and muscle cells, but not on erythrocytes. It is expressed on thymocytes, B cells, monocytes, granulocytes, NK cells, platelets, epithelial and endothelial cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Mu
Applications: BA
Publications for CD46 Antibody (NBP3-15618) (0)
There are no publications for CD46 Antibody (NBP3-15618).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD46 Antibody (NBP3-15618) (0)
There are no reviews for CD46 Antibody (NBP3-15618).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CD46 Antibody (NBP3-15618) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD46 Products
Research Areas for CD46 Antibody (NBP3-15618)
Find related products by research area.
|
Blogs on CD46