Aquaporin-0 Antibody

Western Blot: Aquaporin-0 Antibody [NBP2-92773] - Analysis of extracts of various cell lines, using Aquaporin-0 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Rat brain using MIP antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Human stomach using MIP antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: Aquaporin-0 Antibody [NBP2-92773] - Mouse brain using MIP antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Aquaporin-0 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MIP (NP_036196.1). LALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:1000
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aquaporin-0 Antibody

• aquaporin 0
• lens fiber major intrinsic protein
• major intrinsic protein of lens fiber
• MP26

Background

Aquaporins (AQPs) are a large family of integral membrane channel proteins that facilitate the transport of water through the cell membrane. Aquaporins are widely distributed and are involved in renal water absorption, generation of pulmonary secretions, lacrimation and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. AQP0 is the most abundant endogenous protein in the plasma membrane of lens fiber cells where it functions not only as a water pore, but it is also involved in fiber-fiber adhesion and is crucial for fiber cell structure and organization. AQP0 contains an additional pore constriction, not seen in any other aquaporin structures, which may be responsible for pore gating. The closed AQP0 pore holds just three water molecules, which are spaced too far apart to form hydrogen bonds with each other. The C-terminal domain of AQP0 undergoes extensive post-translational modification, including many truncations, during lens aging due to the actions of m-Calpain, proteases or non-enzymatic mechanisms. These truncation sites may be involved in the development of cataracts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MIP