CD3 epsilon Antibody - BSA Free

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human cerebral cortex, lymph node, spleen and tonsil using Anti-CD3E antibody NBP2-38520 (A) shows similar ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining in human lymph node and pancreas tissues . Corresponding CD3E RNA-seq data are presented for the same tissues.
Western Blot: CD3 epsilon Antibody [NBP2-38520] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver ...read more
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: CD3 epsilon Antibody [NBP2-38520] - Staining of human tonsil.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CD3 epsilon Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD3E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD3 epsilon Antibody - BSA Free

  • CD3 epsilon
  • CD3e antigen
  • CD3e antigen, epsilon polypeptide (TiT3 complex)
  • CD3e molecule, epsilon (CD3-TCR complex)
  • CD3e
  • CD3-epsilon
  • FLJ18683
  • T3E
  • T-cell antigen receptor complex, epsilon subunit of T3
  • T-cell surface antigen T3/Leu-4 epsilon chain
  • T-cell surface glycoprotein CD3 epsilon chain
  • TCRE

Background

CD3 epsilon is a subunit of CD3. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits: CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-16881
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-32636
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-87000
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-76399
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, mIF, Simple Western, WB
MAB7500
Species: Hu
Applications: ICC, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB100-65265
Species: Hu, Mu(-), Rt(-)
Applications: IHC, IHC-Fr, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB

Publications for CD3 epsilon Antibody (NBP2-38520) (0)

There are no publications for CD3 epsilon Antibody (NBP2-38520).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 epsilon Antibody (NBP2-38520) (0)

There are no reviews for CD3 epsilon Antibody (NBP2-38520). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD3 epsilon Antibody (NBP2-38520) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD3 epsilon Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3E
Uniprot