CD3 gamma Antibody


Western Blot: CD3 gamma Antibody [NBP2-32636] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining in human lymph node and small intestine tissues. Corresponding CD3G RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human lymph node shows moderate to strong positivity.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human small intestine shows moderate to strong positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human spleen shows moderate to strong positivity.
Simple Western: CD3 gamma Antibody [NBP2-32636] - Simple Western lane view shows a specific band for CD3G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa more
Simple Western: CD3 gamma Antibody [NBP2-32636] - Electropherogram image of the corresponding Simple Western lane view. CD3G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

CD3 gamma Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Specificity of human CD3 gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD3 gamma Antibody

  • CD3 gamma
  • CD3g antigen
  • CD3g antigen, gamma polypeptide (TiT3 complex)
  • CD3g molecule, epsilon (CD3-TCR complex)
  • CD3g molecule, gamma (CD3-TCR complex)
  • CD3g
  • FLJ17620
  • FLJ17664
  • FLJ79544
  • FLJ94613
  • IMD17
  • MGC138597
  • T3G
  • T-cell antigen receptor complex, gamma subunit of T3
  • T-cell receptor T3 gamma chain
  • T-cell surface glycoprotein CD3 gamma chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: Flow, IHC, IP, CompCytotox, CyTOF-ready, ICC, Tstim
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Mu
Applications: Flow, ICC/IF, IHC-P, IP, In vitro, Func
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for CD3 gamma Antibody (NBP2-32636) (0)

There are no publications for CD3 gamma Antibody (NBP2-32636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 gamma Antibody (NBP2-32636) (0)

There are no reviews for CD3 gamma Antibody (NBP2-32636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD3 gamma Antibody (NBP2-32636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD3 gamma Products

Bioinformatics Tool for CD3 gamma Antibody (NBP2-32636)

Discover related pathways, diseases and genes to CD3 gamma Antibody (NBP2-32636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD3 gamma Antibody (NBP2-32636)

Discover more about diseases related to CD3 gamma Antibody (NBP2-32636).

Pathways for CD3 gamma Antibody (NBP2-32636)

View related products by pathway.

PTMs for CD3 gamma Antibody (NBP2-32636)

Learn more about PTMs related to CD3 gamma Antibody (NBP2-32636).

Research Areas for CD3 gamma Antibody (NBP2-32636)

Find related products by research area.

Blogs on CD3 gamma

There are no specific blogs for CD3 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD3 gamma Antibody and receive a gift card or discount.


Gene Symbol CD3G