CD3 gamma Antibody

Images

 
Western Blot: CD3 gamma Antibody [NBP2-32636] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4
Immunohistochemistry-Paraffin: CD3 gamma Antibody [NBP2-32636] - Staining of human lymph node shows moderate to strong positivity.
Simple Western: CD3 gamma Antibody [NBP2-32636] - Simple Western lane view shows a specific band for CD3G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: CD3 gamma Antibody [NBP2-32636] - Electropherogram image of the corresponding Simple Western lane view. CD3G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD3 gamma Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD3G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Simple Western 1:25
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD3 gamma Recombinant Protein Antigen (NBP2-32636PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD3 gamma Antibody

  • CD3 gamma
  • CD3g antigen
  • CD3g antigen, gamma polypeptide (TiT3 complex)
  • CD3g molecule, epsilon (CD3-TCR complex)
  • CD3g molecule, gamma (CD3-TCR complex)
  • CD3g
  • CD3-GAMMA
  • FLJ17620
  • FLJ17664
  • FLJ79544
  • FLJ94613
  • IMD17
  • MGC138597
  • T3G
  • T-cell antigen receptor complex, gamma subunit of T3
  • T-cell receptor T3 gamma chain
  • T-cell surface glycoprotein CD3 gamma chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB7297
Species: Mu
Applications: Flow, CyTOF-reported
MAB100
Species: Hu
Applications: Flow, IP, CyTOF-reported, ICC, Tstim
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB4841
Species: Mu
Applications: Flow, IHC, IP, CompCytotox, CyTOF-ready, ICC, Tstim
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-32636
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for CD3 gamma Antibody (NBP2-32636) (0)

There are no publications for CD3 gamma Antibody (NBP2-32636).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 gamma Antibody (NBP2-32636) (0)

There are no reviews for CD3 gamma Antibody (NBP2-32636). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD3 gamma Antibody (NBP2-32636) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD3 gamma Products

Bioinformatics Tool for CD3 gamma Antibody (NBP2-32636)

Discover related pathways, diseases and genes to CD3 gamma Antibody (NBP2-32636). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD3 gamma Antibody (NBP2-32636)

Discover more about diseases related to CD3 gamma Antibody (NBP2-32636).
 

Pathways for CD3 gamma Antibody (NBP2-32636)

View related products by pathway.

PTMs for CD3 gamma Antibody (NBP2-32636)

Learn more about PTMs related to CD3 gamma Antibody (NBP2-32636).
 

Research Areas for CD3 gamma Antibody (NBP2-32636)

Find related products by research area.

Blogs on CD3 gamma

There are no specific blogs for CD3 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD3 gamma Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3G
Entrez