CD1b Antibody

Images

 
Western Blot: CD1b Antibody [NBP1-86559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CD1b Antibody [NBP1-86559] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

CD1b Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CD1b Protein (NBP1-86559PEP)

Alternate Names for CD1b Antibody

  • CD1
  • CD1A
  • CD1b antigen
  • CD1B antigen, b polypeptide
  • CD1b molecule
  • CD1b
  • cortical thymocyte antigen CD1B
  • differentiation antigen CD1-alpha-3
  • MGC125990
  • MGC125991
  • R1
  • T-cell surface glycoprotein CD1b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31691
Species: Hu
Applications: WB, IHC, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
MAB4616
Species: Hu
Applications: Flow, CyTOF-ready
MAB6979
Species: Hu
Applications: WB
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
NBP2-37476
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-IC
NBP2-24867
Species: Hu
Applications: Flow, Func, In vitro, In vivo, Flow-CS
NBP1-86559
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD1b Antibody (NBP1-86559) (0)

There are no publications for CD1b Antibody (NBP1-86559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD1b Antibody (NBP1-86559) (0)

There are no reviews for CD1b Antibody (NBP1-86559). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD1b Antibody (NBP1-86559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD1b Antibody Products

Related Products by Gene

Bioinformatics Tool for CD1b Antibody (NBP1-86559)

Discover related pathways, diseases and genes to CD1b Antibody (NBP1-86559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD1b Antibody (NBP1-86559)

Discover more about diseases related to CD1b Antibody (NBP1-86559).
 

Pathways for CD1b Antibody (NBP1-86559)

View related products by pathway.

Research Areas for CD1b Antibody (NBP1-86559)

Find related products by research area.

Blogs on CD1b

There are no specific blogs for CD1b, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our CD1b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD1B
Entrez

Customers Who Bought This Also Bought