CD1a Antibody - BSA Free

Immunohistochemistry-Paraffin: CD1a Antibody [NBP1-86560] - Analysis in human skin and liver tissues using NBP1-86560 antibody. Corresponding CD1A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CD1a Antibody [NBP1-86560] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CD1a Antibody [NBP1-86560] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CD1a Antibody [NBP1-86560] - Staining of human skin shows strong granular cytoplasmic positivity in Langerhans cells.

Immunohistochemistry-Paraffin: CD1a Antibody [NBP1-86560] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD1a Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD1a Antibody - BSA Free (NBP1-86560) is a polyclonal antibody validated for use in IHC. Anti-CD1a Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD1a Protein (NBP1-86560PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD1a Antibody - BSA Free

• CD1
• CD1a antigen
• CD1A antigen, a polypeptide
• CD1a molecule
• CD1a
• cluster of differentiation 1 A
• cortical thymocyte antigen CD1A
• differentiation antigen CD1-alpha-3
• epidermal dendritic cell marker CD1a
• FCB6
• hTa1 thymocyte antigen
• HTA1
• R4
• T6
• T-cell surface antigen T6/Leu-6
• T-cell surface glycoprotein CD1a

Background

All CD1 molecules, except CD1e, are cell surface glycoproteins that are structurally related to the MHC molecules, however, in distinction, CD1 proteins are essentially non polymorphic. CD1 has considerable structural homology with both MHC class I and class II molecules, and CD1 molecules are involved in T cell activation. In contrast to MHC, however, CD1 molecules appear to present predominantly non peptide molecules originating from lipids and glycolipids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CD1a Antibody (NBP1-86560)(2)

Publications using NBP1-86560

• Gunther C, Starke J, Zimmermann N et al. Human 6-sulfo LacNAc (slan) dendritic cells are a major population of dermal dendritic cells in steady state and inflammation. Clin Exp Dermatol 2012-03-01 [PMID: 22188261]
• Gunther C, Zimmermann N, Berndt N et al. Up-regulation of the chemokine CCL18 by macrophages is a potential immunomodulatory pathway in cutaneous T-cell lymphoma. Am J Pathol 2011-09-01 [PMID: 21741937]

Bioinformatics

• Gene Symbol: CD1A