CD14 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: CD14 Antibody [NBP1-86168] - Staining of human cell line SiHa shows localization to vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Analysis in human lymph node and pancreas tissues. Corresponding CD14 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Staining of human liver, lymph node, pancreas and rectum using Anti-CD14 antibody NBP1-86168 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Staining of human tonsil shows moderate membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Staining of human rectum shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Staining of human lymph node shows moderate to strong membranous positivity in lymphoid cells.
Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86168] - Staining of human liver shows moderate to strong membranous positivity in hepatic sinusoid cells.
Independent Antibodies: Analysis using Anti-CD14 antibody NBP1-86168 (A) shows similar pattern to independent antibody NBP1-86166 (B).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

CD14 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit CD14 Antibody - BSA Free (NBP1-86168) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CD14 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CD14 Protein (NBP1-86168PEP)
Publications
Read Publications using
NBP1-86168 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD14 Antibody - BSA Free

  • CD14 antigen
  • CD14 molecule
  • CD14
  • monocyte differentiation antigen CD14
  • Myeloid cell-specific leucine-rich glycoprotein

Background

CD14 is a 53-55 kD glycosylphosphatidylinositol (GPI)-linked membrane glycoprotein also known as LPS receptor. CD14 is expressed at high levels on monocytes and macrophages, and at lower levels on granulocytes. Some dendritic cell populations such as interfollicular dendritic cells, reticular dendritic cells, and Langerhans cells have also been reported to express CD14. As a high-affinity receptor for LPS, CD14 is involved in the clearance of gram-negative pathogens and in the upregulation of adhesion molecules and cytokines expression in monocytes and neutrophils. The M5E2 antibody inhibits monocyte activation and cytokine production induced by LPS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-410-NA
Species: Hu, Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
NB600-1131
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
217-IL
Species: Hu
Applications: BA
LBP
6445-LP/CF
Species: Hu
Applications: BA
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
M4000B
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, mIF, WB
NBP3-14737
Species: Hu
Applications: ICC/IF, IHC, mIF, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
MAB2546
Species: Hu
Applications: CyTOF-ready, Flow
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
1787-MD
Species: Hu
Applications: Bind
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc

Publications for CD14 Antibody (NBP1-86168)(4)

Reviews for CD14 Antibody (NBP1-86168) (0)

There are no reviews for CD14 Antibody (NBP1-86168). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CD14 Antibody (NBP1-86168). (Showing 1 - 1 of 1 FAQs).

  1. I am interested in your anti-human CD14 (NBP1-86168). What concentration does this antibodies has? Does it come in carrier-free form (without protein stabilizer/BSA)?
    • NBP1-86168 is supplied in PBS (pH 7.2) with 40% glycerol and 0.02% sodium azide. The current lot has a concentration of 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional CD14 Products

Research Areas for CD14 Antibody (NBP1-86168)

Find related products by research area.

Blogs on CD14.

The role of TLR4 in breast cancer
Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation.  In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy...  Read full blog post.

CD14 - TLR4 is my friend in battle against infections!
CD14 is a well-characterized cell-activating receptor for lipopolysaccharide-binding protein (LBP) and peptidoglycan. It is an important modulator for lipopolysaccharide (LPS)-dependent signaling and is a component of the multi-protein complex contain...  Read full blog post.

CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity
Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD14 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CD14