CCR9 Recombinant Protein Antigen

Images

 
There are currently no images for CCR9 Recombinant Protein Antigen (NBP3-24721PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CCR9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCR9

Source: E.coli

Amino Acid Sequence: MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCR9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24721It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCR9 Recombinant Protein Antigen

  • C-C chemokine receptor type 9
  • C-C CKR-9
  • CC-CKR-9
  • CCR9
  • CCR-9
  • CD199
  • CDw199 antigen
  • CDw199
  • chemokine (C-C motif) receptor 9
  • G protein-coupled receptor 28
  • GPR28
  • GPR-9-6G-protein coupled receptor 28

Background

CCR9 is encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes. Two alternatively spliced transcript variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

481-TK
Species: Mu
Applications: BA
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
NB100-56319
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC, IHC-Fr, Simple Western, WB
MAB160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
MAB5519
Species: Mu
Applications: CyTOF-ready, Flow, ICC
MAB1567
Species: Hu
Applications: CyTOF-reported, Flow
MAB195
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB533
Species: Mu
Applications: Neut, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
NBP3-24721PEP
Species: Hu
Applications: AC

Publications for CCR9 Recombinant Protein Antigen (NBP3-24721PEP) (0)

There are no publications for CCR9 Recombinant Protein Antigen (NBP3-24721PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCR9 Recombinant Protein Antigen (NBP3-24721PEP) (0)

There are no reviews for CCR9 Recombinant Protein Antigen (NBP3-24721PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CCR9 Recombinant Protein Antigen (NBP3-24721PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCR9 Products

Research Areas for CCR9 Recombinant Protein Antigen (NBP3-24721PEP)

Find related products by research area.

Blogs on CCR9

There are no specific blogs for CCR9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCR9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCR9