| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 10L1L6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR2 (P41597). MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAH |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CCR2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CCR2 Antibody (NBP3-16117)Find related products by research area.
|
|
Rest in Peace: Is the Receptor Interacting Protein (RIP) Kinase-3 (RIPK3) a Protector or Offender? By Jamshed Arslan, Pharm. D., PhD. Receptor interacting protein kinases (RIPKs) in necroptosisDeath is perhaps inevitable. Cell death can be programed and immunologically silent (apoptosis), unprogrammed and inflamm... Read full blog post. |
|
CCR2 or CD192 CCR2 is a receptor for several monocyte chemoattractant proteins (MCP1, MCP3, MCP4) that specifically govern monocyte chemotaxis. CCR2 transduces its downstream signals through increasing intracellular calcium ion levels. For example, MCP1 regulate... Read full blog post. |
|
CCR2: Affecting Autoimmunity via MCP1 interactions CCR2, also known as CD192 (cluster of differentiation 192), is a chemokine receptor and is expressed by monocytes, activated T cells, B cells and natural killer cells. This protein is encoded by CCR2 gene in humans. CCR2 gene encodes two protein isofo... Read full blog post. |
|
MCP1: One Chemoattractant that's Hard to Resist Monocyte Chemoattractant Protein (MCP1) is a potent monocyte attractant, is a member of the CC chemokine subfamily. MCP1 exerts its effects through binding to G-protein-coupled receptors on the surface of leukocytes targeted for activation and migrati... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCR2 |