CCNDBP1 Antibody - BSA Free

Western Blot: CCNDBP1 Antibody [NBP2-58940] - Western blot analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: CCNDBP1 Antibody [NBP2-58940] - Staining of human cell line A-431 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCNDBP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCNDBP1 Antibody - BSA Free (NBP2-58940) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKNVDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCNDBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CCNDBP1 Recombinant Protein Antigen (NBP2-58940PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCNDBP1 Antibody - BSA Free

• cyclin D-type binding-protein 1
• cyclin-D1-binding protein 1
• DIP1HHM Protein
• D-type cyclin-interacting protein 1
• GCIPgrap2 cyclin interacting protein
• Grap2 and cyclin-D-interacting protein
• HHM
• Human homolog of Maid
• MAID protein

Background

CCNDBP1 was identified by the interaction of its gene product with Grap2, a leukocyte-specific adaptor protein important for immune cell signaling. The protein encoded by this gene was shown to interact with cyclin D. Transfection of this gene in cells was reported to reduce the phosphorylation of Rb gene product by cyclin D-dependent protein kinase, and inhibit E2F1-mediated transcription activity. This protein was also found to interact with helix-loop-helix protein E12 and is thought to be a negative regulator of liver-specific gene expression. Two alternatively spliced variants, which encode distinct isoforms, have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCNDBP1