GCAP1 Antibody

Images

 
Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human duodenum shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Pm, RtSpecies Glossary
Applications IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GCAP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCA1A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
Use in Immunohistochemistry-Frozen reported in scientific literature (PMID:35024589).For IHC-Paraffin, HIER pH 6 retrieval is recommended..
Control Peptide
GCAP1 Recombinant Protein Antigen (NBP2-55158PEP)
Publications
Read Publication using
NBP2-55158 in the following applications:

Reactivity Notes

Use in Monkey reported in scientific literature (PMID:35024589) Mouse 88%.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GCAP1 Antibody

  • C6orf131
  • chromosome 6 open reading frame 131
  • CORD14
  • GCAP 1
  • GCAP1photoreceptor 1
  • GCAPGUCA
  • guanylate cyclase activator 1A (retina)
  • Guanylate cyclase activator 1A
  • guanylin 1, retina
  • guanylyl cyclase-activating protein 1
  • GUCA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-68721
Species: Hu, Pm
Applications: IHC, IHC-Fr, IHC-P, WB
NBP3-12211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00005957-M37
Species: Hu
Applications: ELISA, ICC/IF, WB
664-LI/CF
Species: Hu
Applications: BA
NBP3-12219
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24535
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
NBP1-91930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
AF6386
Species: Hu
Applications: IP, WB
NBP1-84996
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00000251-M07
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, ELISA(Cap), S-ELISA, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89724
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-17540
Species: Hu
Applications: ICC/IF, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-55158
Species: Hu, Pm, Rt
Applications: IHC, IHC-Fr, IHC-P

Publications for GCAP1 Antibody (NBP2-55158)(1)

We have publications tested in 1 confirmed species: Monkey.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Monkey
(1)
All Species

Reviews for GCAP1 Antibody (NBP2-55158) (0)

There are no reviews for GCAP1 Antibody (NBP2-55158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GCAP1 Antibody (NBP2-55158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCAP1 Products

Bioinformatics Tool for GCAP1 Antibody (NBP2-55158)

Discover related pathways, diseases and genes to GCAP1 Antibody (NBP2-55158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCAP1 Antibody (NBP2-55158)

Discover more about diseases related to GCAP1 Antibody (NBP2-55158).
 

Pathways for GCAP1 Antibody (NBP2-55158)

View related products by pathway.

PTMs for GCAP1 Antibody (NBP2-55158)

Learn more about PTMs related to GCAP1 Antibody (NBP2-55158).
 

Research Areas for GCAP1 Antibody (NBP2-55158)

Find related products by research area.

Blogs on GCAP1

There are no specific blogs for GCAP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA1A