![Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/GCAP1-Antibody-Immunohistochemistry-Paraffin-NBP2-55158-img0003.jpg "Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human liver shows no positivity in hepatocytes as expected.")
| Reactivity | Hu, Pm, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GUCA1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Use in Immunohistochemistry-Frozen reported in scientific literature (PMID:35024589).For IHC-Paraffin, HIER pH 6 retrieval is recommended.. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
-Western-Blot-H00005957-M37-img0004.jpg)
-ELISA-H00005957-M37-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-H00005957-M37-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NB110-3638-img0005.jpg)
-Immunohistochemistry-Paraffin-NB110-3638-img0001.jpg)
-Western-Blot-NB110-3638-img0002.jpg)
-Western-Blot-H00000251-M07-img0009.jpg)
-Sandwich-ELISA-Capture-H00000251-M07-img0010.jpg)
-Western-Blot-H00000251-M07-img0004.jpg)
-Immunohistochemistry-Frozen-NBP2-59690-img0002.jpg)
-Western-Blot-NBP2-59690-img0004.jpg)
-Immunohistochemistry-NBP2-59690-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0015.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0016.jpg)
-Immunocytochemistry-Immunofluorescence-NB120-2860-img0017.jpg)
| Publication using NBP2-55158 | Applications | Species |
|---|---|---|
| Yamasaki S, Tu H, Matsuyama T et al. A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation iScience 2022-01-01 [PMID: 35024589] (IHC-Fr, Monkey) | IHC-Fr | Monkey |
Secondary Antibodies |
Isotype Controls |
Diseases for GCAP1 Antibody (NBP2-55158)Discover more about diseases related to GCAP1 Antibody (NBP2-55158).
| Pathways for GCAP1 Antibody (NBP2-55158)View related products by pathway.
|
PTMs for GCAP1 Antibody (NBP2-55158)Learn more about PTMs related to GCAP1 Antibody (NBP2-55158).
| Research Areas for GCAP1 Antibody (NBP2-55158)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GUCA1A |
![Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize2/GCAP1-Antibody-Immunohistochemistry-Paraffin-NBP2-55158-img0002.jpg "Immunohistochemistry-Paraffin: GCAP1 Antibody [NBP2-55158] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")