| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCL21 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CCL21/6Ckine Antibody (NBP2-37928)Find related products by research area.
|
|
Meningeal lymphatics: recent discovery defying the concept of central nervous system 'immune privilege' By Jennifer Sokolowski, MD, PhD. Identification and characterization of meningeal lymphaticsThe recent discovery of a lymphatic system in the meninges surrounding the brain and spinal cord has spurred a surge of int... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.