CCL21/6Ckine Antibody - BSA Free

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining in human lymph node and cerebral cortex tissues using anti-CCL21 antibody. Corresponding CCL21 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining of human placenta shows no cytoplasmic positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: CCL21/6Ckine Antibody [NBP2-37928] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCL21/6Ckine Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCL21/6Ckine Antibody - BSA Free (NBP2-37928) is a polyclonal antibody validated for use in IHC. Anti-CCL21/6Ckine Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL21
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 -1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCL21/6Ckine Protein (NBP2-37928PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCL21/6Ckine Antibody - BSA Free

• 6Ckine
• 6CkineSmall-inducible cytokine A21
• Beta-chemokine exodus-2
• CCL21
• chemokine (C-C motif) ligand 21
• CKb9
• exodus-2
• member 21
• SCYA21
• SCYA21MGC34555
• secondary lymphoid tissue chemokine
• SLC
• SLCSecondary lymphoid-tissue chemokine
• TCA-4

Background

CCL21 is found on the p-arm of chromosome 9 with other CC cytokine genes. As part of the cytokine family of proteins, CCL21 is involved in immunoregulatory and inflammatory processes. CCL21 is also thought to have a role in mediating homing of lymphocytes to secondary lymphoid organs. This protein is known to have interactions with UBQLN4, VCAN, CCR7, CTSD and CCBP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCL21/6Ckine Antibody (NBP2-37928)(2)

Publications using NBP2-37928

• Sah V, Jespersen H, Karlsson J et al. Figure S6 from Chemokine analysis in patients with metastatic uveal melanoma suggests a role for CCL21 signaling in combined epigenetic therapy and checkpoint immunotherapy American Association for Cancer Research 2023-05-03 [PMID: 37377898] (IHC-P, Human)
• Andersson S, Nilsson K, Fagerberg L et al. The Transcriptomic and Proteomic Landscapes of Bone Marrow and Secondary Lymphoid Tissues. PLoS One 2014-01-01 [PMID: 25541736] (IF/IHC)

Bioinformatics

• Gene Symbol: CCL21
• Uniprot:
  • O00585()