CCL19/MIP-3 beta Recombinant Protein Antigen

Images

 
There are currently no images for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CCL19/MIP-3 beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCL19/MIP-3 beta.

Source: E. coli

Amino Acid Sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCL19
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56275.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CCL19/MIP-3 beta Recombinant Protein Antigen

  • beta chemokine exodus-3
  • Beta-chemokine exodus-3
  • CC chemokine ligand 19
  • C-C motif chemokine 19
  • CCL19
  • chemokine (C-C motif) ligand 19
  • CKb11
  • EBI1-ligand chemokine
  • ELC
  • ELCMIP-3-beta
  • Epstein-Barr virus-induced molecule 1 ligand chemokine
  • exodus-3
  • Macrophage inflammatory protein 3 beta
  • macrophage inflammatory protein 3-beta
  • MGC34433
  • MIP3 beta
  • MIP-3 beta
  • MIP-3b
  • MIP3BCK beta-11
  • SCYA19EBI1 ligand chemokine
  • small inducible cytokine subfamily A (Cys-Cys), member 19
  • Small-inducible cytokine A19

Background

Macrophage Inflammatory Protein 3 beta is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

366-6C
Species: Hu
Applications: BA
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
350-NS
Species: Fe, Hu, RM
Applications: BA, BA
DM3A00
Species: Hu
Applications: ELISA
DMD00
Species: Hu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB5519
Species: Mu
Applications: CyTOF-ready, Flow, ICC
MAB195
Species: Hu
Applications: CyTOF-ready, Flow, IHC
DIP100
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
MCC170
Species: Mu
Applications: ELISA
MAB172
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
485-MI
Species: Mu
Applications: BA

Publications for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP) (0)

There are no publications for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP) (0)

There are no reviews for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CCL19/MIP-3 beta Products

Research Areas for CCL19/MIP-3 beta Recombinant Protein Antigen (NBP2-56275PEP)

Find related products by research area.

Blogs on CCL19/MIP-3 beta

There are no specific blogs for CCL19/MIP-3 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CCL19/MIP-3 beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL19