CCDC16 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CCDC16 Antibody [NBP1-88165] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: CCDC16 Antibody [NBP1-88165] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-ZNF830 antibody NBP1-88165 (A) shows similar protein distribution across tissues to independent antibody NBP1-88164 (B).

Immunohistochemistry-Paraffin: CCDC16 Antibody [NBP1-88165] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: CCDC16 Antibody [NBP1-88165] - Staining of human lymph node.

Immunohistochemistry-Paraffin: CCDC16 Antibody [NBP1-88165] - Staining of human testis.

Immunohistochemistry-Paraffin: CCDC16 Antibody [NBP1-88165] - Staining of human kidney.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Western Blot: CCDC16 Antibody [NBP1-88165] - Analysis using Anti-ZNF830 antibody NBP1-88165 (A) shows similar pattern to independent antibody NBP1-88164 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCDC16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCDC16 Antibody - BSA Free (NBP1-88165) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGKEHSVSSSREVTSSVLPNDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF830
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CCDC16 Protein (NBP1-88165PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCDC16 Antibody - BSA Free

• CCDC16
• coiled-coil domain containing 16
• Coiled-coil domain-containing protein 16
• MGC20398
• OMCG1
• sel-13 suppressor of lin-12 homolog
• SEL13
• zinc finger protein 830

Background

CCDC16 (coiled-coil domain containing 16) is a U1-like C2H2-type zinc finger protein whose function has not been characterized. Coiled-coil proteins exhibit tertiary structures made up of a number of highly organized alpha helices wound around each other to mediate oligomerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF830