Bub3 Antibody

Images

 
Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: Bub3 Antibody [NBP1-88517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
Western Blot: Bub3 Antibody [NBP1-88517] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Bub3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BUB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Bub3 Protein (NBP1-88517PEP)
Publications
Read Publication using NBP1-88517.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Bub3 Antibody

  • BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog
  • BUB3 budding uninhibited by benzimidazoles 3 homolog
  • Bub3
  • BUB3L
  • budding uninhibited by benomyl
  • budding uninhibited by benzimidazoles 3 homolog (yeast)
  • hBUB3
  • mitotic checkpoint component
  • mitotic checkpoint protein BUB3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-563
Species: Hu
Applications: WB, IHC-P, IP
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
AF4185
Species: Hu
Applications: ICC
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF6028
Species: Hu
Applications: WB, IHC
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Bub3 Antibody (NBP1-88517)(1)

Reviews for Bub3 Antibody (NBP1-88517) (0)

There are no reviews for Bub3 Antibody (NBP1-88517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Bub3 Antibody (NBP1-88517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bub3 Products

Bioinformatics Tool for Bub3 Antibody (NBP1-88517)

Discover related pathways, diseases and genes to Bub3 Antibody (NBP1-88517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bub3 Antibody (NBP1-88517)

Discover more about diseases related to Bub3 Antibody (NBP1-88517).
 

Pathways for Bub3 Antibody (NBP1-88517)

View related products by pathway.

PTMs for Bub3 Antibody (NBP1-88517)

Learn more about PTMs related to Bub3 Antibody (NBP1-88517).
 

Research Areas for Bub3 Antibody (NBP1-88517)

Find related products by research area.

Blogs on Bub3

There are no specific blogs for Bub3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bub3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BUB3
Entrez
Uniprot