Bub3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Bub3 Antibody [NBP1-88517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human cervix, uterine shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Bub3 Antibody [NBP1-88517] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.

Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BUB3 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Bub3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Bub3 Antibody - BSA Free (NBP1-88517) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Bub3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BUB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Bub3 Protein (NBP1-88517PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Bub3 Antibody - BSA Free

• BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog
• BUB3 budding uninhibited by benzimidazoles 3 homolog
• Bub3
• BUB3L
• budding uninhibited by benomyl
• budding uninhibited by benzimidazoles 3 homolog (yeast)
• hBUB3
• mitotic checkpoint component
• mitotic checkpoint protein BUB3

Background

The mitotic checkpoint protein Bub3 appears to be essential during normal mitotic progression, preventing premature sister chromatid separation, missegreation and aneuploidy. Bub3 is also important during G2 and early mitosis stages, promoting normal mitotic entry. Loss of Bub3 function causes slower progression through prophase, apparently due to mitotic cyclins A and B not being accumulated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Bub3 Antibody (NBP1-88517)(1)

Publication using NBP1-88517

• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: BUB3
• Entrez:
  • 9184(Human)
• Uniprot:
  • O43684()