Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YQTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSP |
Specificity | Specificity of human, mouse Bub3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Rat (99%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | BUB3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
Theoretical MW | 37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-88517 | Applications | Species |
---|---|---|
Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012 Apr [PMID: 22361696] |
Secondary Antibodies |
Isotype Controls |
Diseases for Bub3 Antibody (NBP1-88517)Discover more about diseases related to Bub3 Antibody (NBP1-88517).
| Pathways for Bub3 Antibody (NBP1-88517)View related products by pathway.
|
PTMs for Bub3 Antibody (NBP1-88517)Learn more about PTMs related to Bub3 Antibody (NBP1-88517).
| Research Areas for Bub3 Antibody (NBP1-88517)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.