CBX3 Antibody (7B7Q2) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CBX3 (NP_057671.2). MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESD |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CBX3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CBX3 Antibody (7B7Q2)
Background
HP1 gamma appears to be involved in transcriptional silencing in heterochromatin-like complexes. It recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. HP1 gamma may contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR) and involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IP, KD, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu
Applications: BA
Publications for CBX3 Antibody (NBP3-16368) (0)
There are no publications for CBX3 Antibody (NBP3-16368).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CBX3 Antibody (NBP3-16368) (0)
There are no reviews for CBX3 Antibody (NBP3-16368).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CBX3 Antibody (NBP3-16368) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CBX3 Products
Research Areas for CBX3 Antibody (NBP3-16368)
Find related products by research area.
|
Blogs on CBX3