Cathepsin W Antibody

Images

 
Western Blot: Cathepsin W Antibody [NBP1-98601] - Titration: 1.0 ug/ml Positive Control: HepG2 Whole Cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Cathepsin W Antibody Summary

Immunogen
The immunogen for this antibody is Cathepsin W - N-terminal region. Peptide sequence TEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPI.
Clonality
Polyclonal
Host
Rabbit
Gene
CTSW
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cathepsin W Antibody

  • cathepsin W (lymphopain)
  • cathepsin W
  • EC 3.4.22.-
  • lymphopain
  • LYPN

Background

The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene is up-regulated by interleukin-2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2075
Species: Hu
Applications: WB, IHC, IP
MAB9521
Species: Hu, Mu
Applications: WB, IHC, IP
H00001513-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1034
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, ICC, ICFlow
NBP2-33688
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP

Publications for Cathepsin W Antibody (NBP1-98601) (0)

There are no publications for Cathepsin W Antibody (NBP1-98601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin W Antibody (NBP1-98601) (0)

There are no reviews for Cathepsin W Antibody (NBP1-98601). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin W Antibody (NBP1-98601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin W Antibody Products

Related Products by Gene

Bioinformatics Tool for Cathepsin W Antibody (NBP1-98601)

Discover related pathways, diseases and genes to Cathepsin W Antibody (NBP1-98601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin W Antibody (NBP1-98601)

Discover more about diseases related to Cathepsin W Antibody (NBP1-98601).
 

Pathways for Cathepsin W Antibody (NBP1-98601)

View related products by pathway.

PTMs for Cathepsin W Antibody (NBP1-98601)

Learn more about PTMs related to Cathepsin W Antibody (NBP1-98601).

Blogs on Cathepsin W

There are no specific blogs for Cathepsin W, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CTSW
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98601 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought